DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAM and zig-4

DIOPT Version :10

Sequence 1:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:238 Identity:54/238 - (22%)
Similarity:93/238 - (39%) Gaps:46/238 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   572 EYTCNVLVQPQLSTSQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRP 636
            |...|.|..|         ..:|:   :.|.|......|:...:.|.::|.. ..||.|:.:|:.
 Worm    34 EIDTNYLTSP---------AKIKI---VAPLESALIPGGETYQLRCDIMSTP-AATIHWKFNGKL 85

Human   637 IPGSLGVTIDN--IDF----------TSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIV--- 686
            |.||..:.::.  ::|          .|.|.|...|..::|.|:|:..|....:|..:::.:   
 Worm    86 IQGSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNGHQTIETVAEVEIEGE 150

Human   687 --------RVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRI 743
                    :..|:.|.....:..:.|....|.|.|.    ..:.|.:     :...:.:..|.:.
 Worm   151 ASGCRSNHKSAPEIVFWTDSRFEMTGNVATLVCRAN----QQVDWVW-----MSNDELVKNNDKF 206

Human   744 QVLSNGSLLIKHVVEEDSGYYLCKVSNDVG-ADVSKSMYLTVK 785
            .|||||.|:||::|.:|.|.|.|...|..| |.....:|.|.|
 Worm   207 TVLSNGDLVIKNIVWDDMGTYTCIARNQFGEARQETFLYPTAK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAMNP_001380.2 FN3 885..978 CDD:238020
FN3 <937..1300 CDD:442628
Ig_3 1287..1363 CDD:464046
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409353
Ig strand C 55..59 CDD:409353
Ig strand E 79..83 CDD:409353
Ig strand F 99..104 CDD:409353
Ig strand G 112..116 CDD:409353
Ig 125..210 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 192..199 CDD:409353
I-set 235..310 CDD:400151
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..395 CDD:472250
Ig strand B 331..335 CDD:409353
Ig strand C 344..348 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353
Ig 406..501 CDD:472250
Ig strand B 424..428 CDD:409353
Ig strand C 437..441 CDD:409353
Ig strand E 467..471 CDD:409353
Ig strand F 481..486 CDD:409353
Ig strand G 494..497 CDD:409353
IgI_5_Dscam 504..593 CDD:409550 4/20 (20%)
Ig strand A 505..507 CDD:409550
Ig strand A' 512..516 CDD:409550
Ig strand B 519..526 CDD:409550
Ig strand C 533..539 CDD:409550
Ig strand C' 540..542 CDD:409550
Ig strand D 549..553 CDD:409550
Ig strand E 557..563 CDD:409550
Ig strand F 571..579 CDD:409550 2/6 (33%)
Ig strand G 583..593 CDD:409550 0/9 (0%)
Ig 596..686 CDD:472250 22/101 (22%)
Ig strand B 613..617 CDD:409353 0/3 (0%)
Ig strand C 627..631 CDD:409353 2/3 (67%)
Ig strand E 652..656 CDD:409353 2/3 (67%)
Ig strand F 666..671 CDD:409353 2/4 (50%)
Ig strand G 679..682 CDD:409353 1/2 (50%)
Ig_DSCAM 689..784 CDD:409397 25/95 (26%)
putative Ig strand A 689..693 CDD:409397 1/3 (33%)
putative Ig strand A' 698..702 CDD:409397 0/3 (0%)
putative Ig strand B 704..714 CDD:409397 3/9 (33%)
putative Ig strand C 720..726 CDD:409397 1/5 (20%)
putative Ig strand C' 733..736 CDD:409397 0/2 (0%)
putative Ig strand D 744..747 CDD:409397 1/2 (50%)
putative Ig strand E 749..755 CDD:409397 3/5 (60%)
putative Ig strand F 762..770 CDD:409397 3/7 (43%)
putative Ig strand G 775..784 CDD:409397 1/8 (13%)
Ig_DSCAM 785..884 CDD:409398 1/1 (100%)
putative Ig strand A 785..788 CDD:409398 1/1 (100%)
putative Ig strand A' 796..800 CDD:409398
putative Ig strand B 803..810 CDD:409398
putative Ig strand C 818..824 CDD:409398
putative Ig strand C' 833..836 CDD:409398
putative Ig strand D 842..846 CDD:409398
putative Ig strand E 848..854 CDD:409398
putative Ig strand F 861..869 CDD:409398
putative Ig strand G 872..882 CDD:409398
zig-4NP_509335.1 Ig_3 47..134 CDD:464046 21/90 (23%)
IG_like 176..245 CDD:214653 22/77 (29%)
Ig strand B 179..183 CDD:409353 1/3 (33%)
Ig strand C 190..194 CDD:409353 1/8 (13%)
Ig strand E 212..216 CDD:409353 2/3 (67%)
Ig strand F 226..231 CDD:409353 2/4 (50%)
Ig strand G 240..243 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.