DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chil-7 and Cht10

DIOPT Version :9

Sequence 1:NP_496131.2 Gene:chil-7 / 182437 WormBaseID:WBGene00007472 Length:482 Species:Caenorhabditis elegans
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:397 Identity:87/397 - (21%)
Similarity:156/397 - (39%) Gaps:97/397 - (24%)


- Green bases have known domain annotations that are detailed below.


 Worm   123 KCNKRIVGYYTDWEPRKISAKQLQKLTHLIFTNVPMNSSGHVFF-------ENLAQRR--RFLEI 178
            |..|:::.|.::|      |.......|.:...:..|....:.:       ::|..|.  .::::
  Fly   216 KMTKKVLCYMSNW------AFYRSGEAHFVPEQIDPNLCSAIIYSFASLDPDHLTIREFDSWVDL 274

 Worm   179 N----RKAQLMNVKVMFSIGG--HKNAEHYSTVVADSTKRSVFIDSIVSFIKSNNASGVDLFWEW 237
            :    |:...:.|.|:.::||  ..:...||.:|:|:.||.|||.|:.||:..:..||:.|.|.:
  Fly   275 DNQYYRRVTSLGVPVLIALGGWTDSSGSKYSRLVSDNLKRRVFISSVSSFLLRHGFSGLHLDWNY 339

 Worm   238 PN----------ISEMNDFITTIKELRKKLAALTKAQPKGTRYLLSIIVPSSPSDLEYYLRMDGL 292
            |.          :::..:....::|||      |:.|....::.|.:.:......::.......|
  Fly   340 PKCWQSDCSRGPVTDRPNLTKLLRELR------TEFQSVDPKFQLGVAISGYKEIIKEAYDFPAL 398

 Worm   293 LHYVDFLNVLTYGYYAPWSGVNGKFVGPNAPLYGGNRE-----NVDETMQYLICKTRTPSKLNMA 352
            ...||::.|:||.|:..|....|..    :||||.:.:     |.:.|||.|:.......||.::
  Fly   399 SDIVDYMTVMTYDYHGAWEQKTGHV----SPLYGLSSDTYPQYNTNYTMQLLLKMGARREKLVLS 459

 Worm   353 LSFYGRYWENVNDNVPDEMFKEADLINGKAQGMFVAWKNLAGRG------WDKSE-------ALW 404
            :.|||:.:.                       :..|.:.|||.|      .|..|       ..:
  Fly   460 IPFYGQSFT-----------------------LATAHQILAGPGVAASGPGDAGELTKQPGMLAY 501

 Worm   405 HEETQ--IPYIWNSEERKFFVF-------------ENERSLQAKMDYAADHNIGGVYIWALGADD 454
            :|..|  ..:.|.|:.....:|             |:..|.|||..|||::|..||..|.:..||
  Fly   502 YEICQRLTKFNWISDRNLNVIFGPFAMLNDQWVGYEDPTSAQAKARYAANNNFAGVAAWTIDLDD 566

 Worm   455 NNDTLLN 461
            ..:...|
  Fly   567 FRNLCCN 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chil-7NP_496131.2 Glyco_18 127..453 CDD:214753 82/383 (21%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753 82/383 (21%)
GH18_chitolectin_chitotriosidase 221..586 CDD:119351 85/392 (22%)
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164207
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.