DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Numbl and Aplip1

DIOPT Version :10

Sequence 1:NP_001403961.1 Gene:Numbl / 18223 MGIID:894702 Length:608 Species:Mus musculus
Sequence 2:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster


Alignment Length:121 Identity:39/121 - (32%)
Similarity:56/121 - (46%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    88 YLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKS---VLWVSADGLRVVD-------DKTKDLLVD 142
            |||.||....:|..|...||:|:......|...   :|.||..|||:||       .|.|...:|
  Fly   351 YLGSVETLAHKGTGVVCQAVRKIVGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQNKKDKKPCID 415

Mouse   143 --QTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAF 196
              .:::.|||||......:...:|.:..|.:|:.||.|.. .:|...::.|||.||
  Fly   416 YFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKG-SESTRPVAEAVGRAF 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NumblNP_001403961.1 PTB_Numb 68..202 CDD:241298 39/121 (32%)
PHA03247 <263..594 CDD:223021
NumbF 291..375 CDD:461874
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 39/121 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.