DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Numbl and CG14968

DIOPT Version :10

Sequence 1:NP_001403961.1 Gene:Numbl / 18223 MGIID:894702 Length:608 Species:Mus musculus
Sequence 2:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster


Alignment Length:192 Identity:40/192 - (20%)
Similarity:64/192 - (33%) Gaps:57/192 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    83 SFPVRYLGHVEVEESRGM----------HVCEDAVKKL---KAMGRKSVKSVLWVSADG--LRVV 132
            :|.|:|:|.   |.:||:          .:.....|.|   |.:....:|    ||.||  |.::
  Fly    23 TFKVKYIGS---EVARGLWGIKYTRRPVDIMVGVAKNLPPNKVLPNCELK----VSTDGVQLEII 80

Mouse   133 DDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFA 197
            ..|.........|:.:|:...|....:.|:.|               .:||  |...|.......
  Fly    81 SPKASINHWSYPIDTISYGVQDLVYTRVFAMI---------------VVKD--ESSPHPFEVHAF 128

Mouse   198 ACLERKQRREKECGVTAAF-DASRTSFAREGSFRLSGGGRPAEREAGDKKKAEAAAAPAVAP 258
            .|..|...|:....:.||| |.||                 ..:||..:::.||..:..:.|
  Fly   129 VCDSRAMARKLTFALAAAFQDYSR-----------------RVKEATGEEEGEATPSDTITP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NumblNP_001403961.1 PTB_Numb 68..202 CDD:241298 27/133 (20%)
PHA03247 <263..594 CDD:223021
NumbF 291..375 CDD:461874
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 30/147 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.