DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntsr2 and PK2-R2

DIOPT Version :9

Sequence 1:NP_032773.2 Gene:Ntsr2 / 18217 MGIID:108018 Length:416 Species:Mus musculus
Sequence 2:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster


Alignment Length:379 Identity:100/379 - (26%)
Similarity:163/379 - (43%) Gaps:86/379 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 PRPSPSAGLSLEARLGVDTRLWAKVLFTALYSLIFALGTAGNALSVHVVLKARAGRPGRLRYHVL 73
            |..:|...|||.|.|.|.            |:|||..|..||.::. :|:...........:::.
  Fly    55 PTVTPMTPLSLLATLSVG------------YALIFIAGVLGNLITC-IVISRNNFMHTATNFYLF 106

Mouse    74 SLALSALLLLLISVPMELYNFVW--SHYPWVFGDLGCRGYYFVRELCAYATVLSVASLSAERCLA 136
            :||:|.::||...:|.:||| :|  .:||  |.|..|.....:.|..|.||||::.:.:.||.:|
  Fly   107 NLAISDMILLCSGMPQDLYN-LWHPDNYP--FSDSICILESVLSETAANATVLTITAFTVERYIA 168

Mouse   137 VCQPLRARRLLTPRRTRRLLSLVWVASLGLALPMA----VIMGQKHEMERADGEPEPASRVCTVL 197
            :|.|.|...:....|..:.:..:|:|:|.||||.|    |:|             :.....||: 
  Fly   169 ICHPFRQHTMSKLSRAVKFIFAIWIAALLLALPQAIQFSVVM-------------QGMGTSCTM- 219

Mouse   198 VSRATLQVFIQVNVLVSFVLPLALTAFLNGITVNHLVALYSQVPSASAQVNSIPSRLELLSEEGL 262
                       .|...:.|..::...|..| .:..:..||.                       |
  Fly   220 -----------KNDFFAHVFAVSGFLFFGG-PMTAICVLYV-----------------------L 249

Mouse   263 LGFITWRKTLSLGVQASLVRHKDASQIRSLQHSAQVLRAIVAV---YVICWLPYHARRLMYCYIP 324
            :|....|..|   :||...|..|.:  |.:....:|:|.:|||   :.|||.|:||:|||..|..
  Fly   250 IGVKLKRSRL---LQALPRRCYDVN--RGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYGS 309

Mouse   325 DDG----WTDELYDFYHYFYMVTNTLFYVSSAVTPVLYNAVSSSFRKLFLESLS 374
            ..|    |.::::....|   .:..|:::|:.:.|:|||.:|..||:.|..:|:
  Fly   310 TSGIESQWFNDVFSILDY---TSGVLYFLSTCINPLLYNIMSHKFREAFKVTLA 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntsr2NP_032773.2 7tm_1 85..358 CDD:278431 71/285 (25%)
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 79/321 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.