DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nras and Rap1

DIOPT Version :9

Sequence 1:XP_006501181.1 Gene:Nras / 18176 MGIID:97376 Length:220 Species:Mus musculus
Sequence 2:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster


Alignment Length:194 Identity:103/194 - (53%)
Similarity:133/194 - (68%) Gaps:15/194 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    32 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 96
            |.|||:||:|:|||||||||:|.:|..||::|||||||||||||.:||:.|:|:||||||.|:::
  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

Mouse    97 AMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL-PTRTVDTKQ 160
            ||||.||:.|:||:.|::|....:|.|:...||||.||||:|||||||||||||| ..|.|..:.
  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130

Mouse   161 AHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIR----QYRMKKLNSSDDGTQGCMGLPCVLM 220
            ...||..:...|:|||||.:..|.|.||.|||:|.    :.:.||...|          .|||:
  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKS----------LCVLL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrasXP_006501181.1 H_N_K_Ras_like 34..195 CDD:133338 95/161 (59%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 95/161 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.