DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpd-2 and CG32379

DIOPT Version :9

Sequence 1:NP_510625.2 Gene:cpd-2 / 181684 WormBaseID:WBGene00012073 Length:492 Species:Caenorhabditis elegans
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:343 Identity:73/343 - (21%)
Similarity:128/343 - (37%) Gaps:82/343 - (23%)


- Green bases have known domain annotations that are detailed below.


 Worm    23 EEQMLIRHFTKEGEVSTMDQLRDTI---GPFRDPLNFSHMNYSTLTDHIHNLHRKFPNLTHIYSA 84
            |.::||............:.||..:   .|..|.|: :...:|.:.|::.:|..:||....:...
  Fly     7 EYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLS-AFYTHSEINDYLDSLLERFPKRVQVKQF 70

 Worm    85 GQSVQGRELWVLVVSRYPIEHRKLIPEFKYVANMHGNEVTGRVFLVSLAHTLLENYNSNLWIRQL 149
            |.|.:.|.|.||.::..  :.|:..|.......:|..|.......:.:...||:||..|   ::|
  Fly    71 GWSYERRPLKVLTITNG--DGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDN---QEL 130

 Worm   150 VDSTRIHLMPSMNPDGYEHASEGDQAGVTGRQNAN-----GKDLNRNF-------------PS-- 194
            :......:||.:|.||||:.....:.....|:..:     |.|:||||             |.  
  Fly   131 LQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSDPCEN 195

 Worm   195 --RFPNYFPTSEIQPETIAIMNWTRQIPFALSANLHGGTTLVNYPF-DDFPTRTRQSHYAPSPDN 256
              |....|..||.|.....::::..::.|.||.:.:|...|:.:.: .|||.             
  Fly   196 IYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPD------------- 247

 Worm   257 ALFVRLAYTYARGHERMWKKGPRCLDDDLNIS-------VDPQNGIIN-GADWYIV---SGGMQD 310
                    ||               .|.::::       :...|||.: |:.:|::   ||...|
  Fly   248 --------TY---------------QDMMSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTD 289

 Worm   311 WNYLNTNCFEVTVEMNCE 328
            :.:...|   .||.|..|
  Fly   290 FAFGVVN---ATVAMTME 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpd-2NP_510625.2 M14_CP_N-E_like 58..352 CDD:349431 65/305 (21%)
Peptidase_M14NE-CP-C_like 358..433 CDD:200604
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 65/305 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4667
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.