DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C18B12.4 and DMA1

DIOPT Version :9

Sequence 1:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans
Sequence 2:NP_011983.1 Gene:DMA1 / 856515 SGDID:S000001157 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:301 Identity:61/301 - (20%)
Similarity:107/301 - (35%) Gaps:83/301 - (27%)


- Green bases have known domain annotations that are detailed below.


 Worm    39 EEELVHKCLAKGGNFGMDVSDFIISEENLGCGVGV--EPV---DACGPVRIAQNHTTRCHNLFAF 98
            ::..:.:.:.|.|.|.:.::.||.:........|:  :|:   ...|...|...:|.|.      
Yeast   140 DQSTLKRRMDKHGLFSIRLTPFIDTSSTSVANQGLFFDPIIRTAGAGSQIIIGRYTERV------ 198

 Worm    99 VSRSNIS------HPCKF-------SHQAFMVQNSTYPFRLVIFYNYPGQEPISMEGTELRDKVN 150
              |..||      ||..|       :|..|.|.:..         |:..::..|..||.|..:  
Yeast   199 --REAISKIPDQYHPVVFKSKVISRTHGCFKVDDQG---------NWFLKDVKSSSGTFLNHQ-- 250

 Worm   151 IPVLMISHACKEEIAKKFSDTAGYRLRVRIDPGYYELFRYLIPFLVVIVFCFALFLITLCVRGCV 215
                .:|.|..........|....:|.:....|..|::|                    ||:..:
Yeast   251 ----RLSSASTTSKDYLLHDGDIIQLGMDFRGGTEEIYR--------------------CVKMKI 291

 Worm   216 ERRK--------LNKRRLSK-RNLKKIPVKKYRLGDDPDTCAICLESFASGEKLRHLPCRHVFHC 271
            |..|        .||..||: :||:|:..     |.:.:.|:|||......:.:...||.|.:|.
Yeast   292 ELNKSWKLKANAFNKEALSRIKNLQKLTT-----GLEQEDCSICLNKIKPCQAIFISPCAHSWHF 351

 Worm   272 NCID--VWLTQTRKICPLCKRK------IGTDSDSECSTND 304
            :|:.  |.:...:.:||.|:..      :.::|:||....|
Yeast   352 HCVRRLVIMNYPQFMCPNCRTNCDLETTLESESESEFENED 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C18B12.4NP_510498.1 PA <74..176 CDD:333703 22/117 (19%)
HRD1 <223..>335 CDD:227568 23/91 (25%)
RING-H2_RNF103 246..291 CDD:319387 13/46 (28%)
DMA1NP_011983.1 FHA 121..308 CDD:224630 38/210 (18%)
RING-H2_Dmap_like 325..371 CDD:319372 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.