DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C18B12.4 and ETP1

DIOPT Version :9

Sequence 1:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans
Sequence 2:NP_011853.1 Gene:ETP1 / 856376 SGDID:S000001002 Length:585 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:64/285 - (22%)
Similarity:105/285 - (36%) Gaps:85/285 - (29%)


- Green bases have known domain annotations that are detailed below.


 Worm   209 LCVRGCVERRKLNKRRLSKRN----------LKKIPVKKYRLGDDPDTCAICLESFASGEK-LRH 262
            :.|:..|.::||.:|..:..:          :||   ||..:..:..||.:|||...|... |..
Yeast   195 ISVKEIVFQKKLFQRPAANEDFPYLLTDPFTVKK---KKELVKVELPTCPVCLERMDSETTGLVT 256

 Worm   263 LPCRHVFHCNCIDVWLTQTRKICPLCKR---KIGTDS-------DSEC----STNDLASTSQGPN 313
            :||:|.|||.|::.|....   ||:|:.   ::..:|       .:.|    ||::|.......|
Yeast   257 IPCQHTFHCQCLNKWKNSR---CPVCRHSSLRLSRESLLKQAGDSAHCATCGSTDNLWICLICGN 318

 Worm   314 DATALYNNADNQSGFELPV----------------------------PQGQMV-----------D 339
            .....||:......:|..:                            ..|::|           |
Yeast   319 VGCGRYNSKHAIKHYEETLHCFAMDIRTQRVWDYAGDNYVHRLVQNEVDGKLVEVGGSGDDDNND 383

 Worm   340 LWSSQEALVDQDIVLHNTTRRSITGFVRNAFRK----LRNSPRHRDVDVHSGLEGGSYLVRQQTT 400
            :.:|.|.   |::|..|   ||..|...|:.:|    ..|..|||:..    ||....|: .|..
Yeast   384 IGNSDEL---QNVVYGN---RSKNGEKSNSNKKDGELAANFLRHREYH----LEYVQVLI-SQLE 437

 Worm   401 SNDNDHLLENEVSDPTSSSELNIPS 425
            |....:.|:.:..|.|:|...|:.|
Yeast   438 SQREYYELKLQEKDQTASDSSNVES 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C18B12.4NP_510498.1 PA <74..176 CDD:333703
HRD1 <223..>335 CDD:227568 32/164 (20%)
RING-H2_RNF103 246..291 CDD:319387 18/48 (38%)
ETP1NP_011853.1 RRM_ETP1 114..201 CDD:410116 1/5 (20%)
RING-H2_BRAP2 238..281 CDD:319371 18/45 (40%)
zf-UBP 301..363 CDD:396634 8/61 (13%)
Smc 409..>534 CDD:224117 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.