DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C18B12.4 and APC11

DIOPT Version :9

Sequence 1:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans
Sequence 2:NP_010276.3 Gene:APC11 / 851554 SGDID:S000002166 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:61 Identity:21/61 - (34%)
Similarity:28/61 - (45%) Gaps:12/61 - (19%)


- Green bases have known domain annotations that are detailed below.


 Worm   242 DDPDTCAICLESFASGEKLRHLP----------CRHVFHCNCIDVWL-TQTRK-ICPLCKR 290
            :|.|.|.||..|:.........|          |.|.||.:||..|| |.|.| :||:|::
Yeast    36 EDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C18B12.4NP_510498.1 PA <74..176 CDD:333703
HRD1 <223..>335 CDD:227568 21/61 (34%)
RING-H2_RNF103 246..291 CDD:319387 19/57 (33%)
APC11NP_010276.3 zf-ANAPC11 1..102 CDD:403920 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.