powered by:
Protein Alignment C18B12.4 and APC11
DIOPT Version :9
Sequence 1: | NP_510498.1 |
Gene: | C18B12.4 / 181600 |
WormBaseID: | WBGene00007666 |
Length: | 456 |
Species: | Caenorhabditis elegans |
Sequence 2: | NP_010276.3 |
Gene: | APC11 / 851554 |
SGDID: | S000002166 |
Length: | 165 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 61 |
Identity: | 21/61 - (34%) |
Similarity: | 28/61 - (45%) |
Gaps: | 12/61 - (19%) |
- Green bases have known domain annotations that are detailed below.
Worm 242 DDPDTCAICLESFASGEKLRHLP----------CRHVFHCNCIDVWL-TQTRK-ICPLCKR 290
:|.|.|.||..|:.........| |.|.||.:||..|| |.|.| :||:|::
Yeast 36 EDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.