DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C18B12.4 and rnf13

DIOPT Version :9

Sequence 1:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans
Sequence 2:NP_957338.1 Gene:rnf13 / 793981 ZFINID:ZDB-GENE-040426-772 Length:377 Species:Danio rerio


Alignment Length:379 Identity:103/379 - (27%)
Similarity:162/379 - (42%) Gaps:83/379 - (21%)


- Green bases have known domain annotations that are detailed below.


 Worm    63 SEENLGCGVGVEPVDACGPVRIAQNHTTRCHNLFAFVSRSNISHPCKFSHQAFMVQNSTYPFRLV 127
            ||...|..:|..|.:||.|:................:.|.:    |.|..:....|.:.|  :..
Zfish    61 SEGLKGFLIGARPENACVPIEPPPQRENLSSAFIVLIRRFD----CNFDIKVLHAQKAGY--KAA 119

 Worm   128 IFYNYPGQEPISM--EGTELRDKVNIPVLMISHACKEEIAKKFSDTAGYRL--RVRIDPGY-YEL 187
            |.:|....:.|||  |..::..:::||.:.|.    ||.|....:...|..  .|.:.|.: ..|
Zfish   120 IVHNVDSDDLISMGSEDLDILKQIDIPSVFIG----EEAANSLKEDYIYEKGGHVILMPDFSLPL 180

 Worm   188 FRYLIPFLVVIVFCFALFLITLCVRGCVERRKLNKRRLSKRNLKKIPVKKYRLGDDPDTCAICLE 252
            ..||||||:::..|..|.::.:..:...:|.:..:.||.|..|||:|:.|::.||..|.|||||:
Zfish   181 EYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSRLRKDQLKKLPIHKFKKGDSYDVCAICLD 245

 Worm   253 SFASGEKLRHLPCRHVFHCNCIDVWLTQTRKICPLCKRK-IGTDSDSECSTNDLASTSQGPNDAT 316
            .:..||:||.|||.|.:||.|:|.|||:|:|.||:||:| :.:|.|||..::.:.|..:      
Zfish   246 EYEEGERLRVLPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSDGDSESDSDSVDSGGE------ 304

 Worm   317 ALYNNADNQSGFELPVPQGQMVDLWSSQEALVDQDIVLHNTTRRSITGFVRNAFRKLRNSPRHRD 381
                  ||:.....|:                          .||:.....::|..:..|     
Zfish   305 ------DNEVSENTPL--------------------------LRSLASTSAHSFGSMSAS----- 332

 Worm   382 VDVHSGLEGGSYLVRQQTTSNDNDHLLENEVSDPTSSSELNIPSSEELTVPTSI 435
                        |.:....|:|.|     |.||   ||:    |.||:||.|.:
Zfish   333 ------------LSQHDAGSSDYD-----ERSD---SSD----SEEEVTVETVV 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C18B12.4NP_510498.1 PA <74..176 CDD:333703 22/103 (21%)
HRD1 <223..>335 CDD:227568 46/112 (41%)
RING-H2_RNF103 246..291 CDD:319387 26/44 (59%)
rnf13NP_957338.1 PA_C_RZF_like 23..180 CDD:239038 28/128 (22%)
zf-RING_2 238..282 CDD:290367 25/43 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I6493
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I3514
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - otm12347
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1776
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.