DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DRD5 and drd5

DIOPT Version :9

Sequence 1:NP_000789.1 Gene:DRD5 / 1816 HGNCID:3026 Length:477 Species:Homo sapiens
Sequence 2:XP_004911296.1 Gene:drd5 / 100495174 XenbaseID:XB-GENE-992519 Length:455 Species:Xenopus tropicalis


Alignment Length:443 Identity:310/443 - (69%)
Similarity:352/443 - (79%) Gaps:33/443 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    40 QVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVA 104
            |:||..||.|||.|||.||:|||.|::|.||||..:||:||||||||||.|||||||||||||||
 Frog    41 QIVTGSLLLLLIFWTLFGNILVCTAVMRFRHLRNRVTNIFIVSLAVSDLLVALLVMPWKAVAEVA 105

Human   105 GYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSI 169
            |:||||||||:||||||||||||||||||||||||||||.||||:||||||:||:|:..||.||:
 Frog   106 GHWPFGAFCDIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTQRVALLMISAAWALSV 170

Human   170 LISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISF 234
            |||||||||:||:.:.                   :|....:.:..|||||||||||||||||||
 Frog   171 LISFIPVQLSWHKSET-------------------DDHLLSNQSTGNCDSSLNRTYAISSSLISF 216

Human   235 YIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAA-CA-PDTSLRASIKKETKVLKT 297
            |||||||||||||||||||:||||||:|||||||||||||:.. |. ..:||:.|||||||||||
 Frog   217 YIPVAIMIVTYTRIYRIAQIQIRRISTLERAAEHAQSCRSNRVDCRHHQSSLKTSIKKETKVLKT 281

Human   298 LSVIMGVFVCCWLPFFILNCMVPFC---SGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIY 359
            ||:||||||||||||||||||||||   ||||:   ||.|||||||||:|||||||||||||:||
 Frog   282 LSIIMGVFVCCWLPFFILNCMVPFCDRSSGHPQ---AGLPCVSETTFDIFVWFGWANSSLNPIIY 343

Human   360 AFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNRE 424
            ||||||:|||:.||||.|:||.||||||||||||||||||.:|||:|..||::|:||.|.     
 Frog   344 AFNADFRKVFSSLLGCGHWCSTTPVETVNISNELISYNQDTIFHKDIVTAYVNMIPNVVD----- 403

Human   425 VDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH 477
             ..|:.|..||.|.||.|||.:.:...:|:.|||.|.:|||.||||..|||.|
 Frog   404 -CIDDNEDAFDHMSQISQTSANNELATDSMCELDSEVDISLHKITPSMPNGIH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DRD5NP_000789.1 7tm_1 57..359 CDD:278431 227/306 (74%)
7tm_4 <123..>175 CDD:304433 42/51 (82%)
drd5XP_004911296.1 7tm_GPCRs 42..353 CDD:391938 246/332 (74%)
TM helix 1 44..68 CDD:341315 15/23 (65%)
TM helix 2 78..100 CDD:341315 19/21 (90%)
TM helix 3 115..137 CDD:341315 20/21 (95%)
TM helix 4 160..176 CDD:341315 9/15 (60%)
TM helix 5 205..228 CDD:341315 22/22 (100%)
TM helix 6 276..301 CDD:341315 23/24 (96%)
TM helix 7 322..347 CDD:341315 22/24 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 457 1.000 Domainoid score I4570
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20216
Inparanoid 1 1.050 613 1.000 Inparanoid score I6288
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1045889at2759
OrthoFinder 1 1.000 - - FOG0001416
OrthoInspector 1 1.000 - - oto157775
Panther 1 1.100 - - LDO PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X883
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.160

Return to query results.
Submit another query.