DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment idhb-1 and CG32026

DIOPT Version :9

Sequence 1:NP_510362.1 Gene:idhb-1 / 181528 WormBaseID:WBGene00007993 Length:379 Species:Caenorhabditis elegans
Sequence 2:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster


Alignment Length:382 Identity:129/382 - (33%)
Similarity:217/382 - (56%) Gaps:42/382 - (10%)


- Green bases have known domain annotations that are detailed below.


 Worm    31 TAPRPPTELNQKLK-------------------------VTIIPGDGVGPELIYTVQDIVKQTGI 70
            :|.:|||.....:|                         :|::||||:|||:...|..|::....
  Fly   346 SASKPPTASKPPVKSPAGGQGQKGGAGGKSGKASGEPRVITLMPGDGIGPEISMAVIKILEAAKT 410

 Worm    71 PIEFEEIFLSEVHYTR--SSSIENAVESIGRNNNVALKGAIEESAVLHTEGELQGLNMRLRRSLD 133
            |:.||.:.::.|..::  :|..|..:||:.| ..|.|||.:    :.......:.||:.||:..:
  Fly   411 PLIFEPVDVTPVLNSQGMTSVPEQVIESMNR-TKVGLKGPL----MTPVGTGFRSLNLTLRQLFN 470

 Worm   134 LFANVVHIKTLDGIKTRHGKQLDFVIVREQTEGEYSSLEHELVPGVIECLKISTRTKAERIAKFA 198
            |:||:...::|.|::|.:| .:|.|.:||.||||||.:||.||.||::.:|:.||..:.|:|::.
  Fly   471 LYANIRPCRSLPGVETVYG-DVDIVTIRENTEGEYSGIEHTLVNGVVQSIKLITRNASLRVAEYT 534

 Worm   199 FDYATKTGRKKVTAVHKANIMKLGDGLFLRTCEGVAKQYPK------IQFESMIIDNTCMQLVSK 257
            |.||....|||||||.::.:|::.||||||....:|.:|..      |::|...:...|:.:|..
  Fly   535 FQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKYKSKMDQAGIKYEESTMTTVCLNIVQD 599

 Worm   258 PEQFDVMVMPNLYGNIIDNLAAGLVGGAGVVPGQSVGRDFVIFEPGSRH-SFQEAMGRSIANPTA 321
            |:::|::|:|||||:||.:..|||:||.|:.|..:||.:..|||  |.| :..:..|:.:|||||
  Fly   600 PKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTNGAIFE--SVHGTAPDIAGKDLANPTA 662

 Worm   322 MILCAANMLNHLHLDAWGNSLRQAVADVVKEGKVRTRDLGGYATTVDFADAVIDKFR 378
            ::|.:..||:::.|....:.:.:||...:::..:||.||||.|...::.||:|...:
  Fly   663 LLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRTMDLGGKAKCSEYTDALIKNLK 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
idhb-1NP_510362.1 mito_nad_idh 40..377 CDD:272942 125/370 (34%)
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004 5/14 (36%)
Iso_dh 382..718 CDD:294303 124/343 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.