DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akt-2 and S6k

DIOPT Version :9

Sequence 1:NP_510357.3 Gene:akt-2 / 181524 WormBaseID:WBGene00000103 Length:528 Species:Caenorhabditis elegans
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:410 Identity:157/410 - (38%)
Similarity:232/410 - (56%) Gaps:31/410 - (7%)


- Green bases have known domain annotations that are detailed below.


 Worm   128 MQEEDTNGNPSGESDVNMD--------ATSTRSDNDFESTVMNIDEPEEVPRKNTVTMDDFDFLK 184
            ::.:|.....|.:..:.:|        ..:...|.:.:.|:...:|... |.|..:...||:..|
  Fly    18 LELQDDKARDSDDDRIELDDVDLEPELCINLHQDTEGQETIQLCEENVN-PGKIKLGPKDFELKK 81

 Worm   185 VLGQGTFGKVILCRE---KSSDKLYAIKIIRK-EMVVDRSEVAHTLTENRVLYACVHPFLTLLKY 245
            |||:|.:|||...|:   :.::|.:|:|:::| .:|.::.:.|||..|..:|.|..|||:..|.|
  Fly    82 VLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVY 146

 Worm   246 SFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYGSEIILALGYLHHRNIVYRDMKLENLL 310
            :||....:..::|:.:|||||.||:|...|.|..|.||.||||||||:||...|:|||:|.||:|
  Fly   147 AFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENIL 211

 Worm   311 LDRDGHIKITDFGLCKEEIKYGDKTSTFCGTPEYLAPEVIEDIDYDRSVDWWGVGVVMYEMMCGR 375
            ||..||:|:||||||||.|:.|..|.|||||.||:|||::....:.::||||.:|.:|::|:.|.
  Fly   212 LDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGV 276

 Worm   376 LPFSAKENGKLFELITTCDLKFPNRLSPEAVTLLSGLLERVPAKRLGAGPDDAREVSRAEFFKDV 440
            .||:|:...|..|.|....|..|..|:|||..|:..|::|...:|||:||:||..|....|||.|
  Fly   277 PPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHV 341

 Worm   441 DWEATLRKEVEPPFKPNVMSETDTSFFDREFTSMPVQLTPPRRGEELPTVDEEEEL----QANFI 501
            :|:..|.:.:|||.||.:.||.|.|.||..||            .::| ||..::.    .||.|
  Fly   342 NWDDVLARRLEPPIKPLLRSEDDVSQFDTRFT------------RQIP-VDSPDDTTLSESANLI 393

 Worm   502 -QFASYYVSGSLERSYDTNR 520
             |..:|.....||..:..||
  Fly   394 FQGFTYVAPSILEDMHRANR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akt-2NP_510357.3 PH_PKB 11..116 CDD:269947
PH 13..115 CDD:278594
S_TKc 180..437 CDD:214567 117/260 (45%)
PKc_like 184..509 CDD:304357 143/333 (43%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 144/333 (43%)
STKc_p70S6K 81..402 CDD:270736 143/333 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.