DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkb-3 and CG33310

DIOPT Version :9

Sequence 1:NP_510300.1 Gene:nkb-3 / 181494 WormBaseID:WBGene00010117 Length:317 Species:Caenorhabditis elegans
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:305 Identity:63/305 - (20%)
Similarity:108/305 - (35%) Gaps:88/305 - (28%)


- Green bases have known domain annotations that are detailed below.


 Worm    28 QFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLRTLDPKVPRFYGKGTIIGVN 92
            :..:||..|....|..:.|....||.:::.:|:..|.:............|||      .|....
  Fly   586 RLFFNKIHGKYKLRRPSHWLYTLVFSVLYILFVIIFSMAWFDFIKDDASRKVP------MIKMAQ 644

 Worm    93 PGVGYQP-WLKENPDSTLIKFNLQDSKSWEPYVKQLDNY------LSKYKNTNETRDCGASDNND 150
            |.:.:.| ..:.||.:  :.|:.::|      .:.::.|      |.||         |...:|.
  Fly   645 PFISFTPIGPRTNPKA--VSFDPRNS------TEVMEKYAGIMALLEKY---------GDYGHNP 692

 Worm   151 ALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGR 215
            ...|                  |.|.:::||.||:|||.:.:||:||::...|.:..  |.:|.:
  Fly   693 RFGT------------------CTANEKFGYPSGEPCVFLKVNRIIGFKTEPYINSD--ELVKAK 737

 Worm   216 YKPGSIT--------------------INCEGATSFDKEHLGKVKYIPETGIDGRY------YPY 254
            ......|                    |.|..    ||:....:::.||..|...|      ..|
  Fly   738 IDEVEFTALKRLLENTTTEEGHLNRTWITCRS----DKDKNVLIEFHPEPAIRTEYTDIEEKIEY 798

 Worm   255 V--------FVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEH 291
            :        |.|:....|..:|...:..|:.|.:.|:.:|.||.|
  Fly   799 IANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNIHH 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nkb-3NP_510300.1 Na_K-ATPase 24..300 CDD:278704 63/305 (21%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 35/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.