DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ensh-1 and CG31832

DIOPT Version :9

Sequence 1:NP_001024508.1 Gene:ensh-1 / 181135 WormBaseID:WBGene00017013 Length:465 Species:Caenorhabditis elegans
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:190 Identity:60/190 - (31%)
Similarity:94/190 - (49%) Gaps:28/190 - (14%)


- Green bases have known domain annotations that are detailed below.


 Worm   231 GSPSGVYSIQ--SVEKFQAFCDMDTTTGGWTVIQRRVDGDGSFHRGTMKKFVEGFGNLQGSHWLG 293
            |||:|::.:.  ..|.||. ....||...|.|||||:||..:|::... .:.:|||:..|..::|
  Fly    28 GSPNGIHQLMLPEEEPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWF-SYKDGFGDPNGEFFIG 90

 Worm   294 LEKLHNLAPIGATPAILRIEIQ---GETCDLTCSKRFANTWVGEWKVNFGKKQDGYKIQITEEGV 355
            |:||:.:.  ...|..|.|:::   |.|.       :|:  ..:::|:  .:.:.||:    |.|
  Fly    91 LQKLYLMT--REQPHELFIQLKHGPGATV-------YAH--FDDFQVD--SETELYKL----ERV 138

 Worm   356 GNLTYNGVDPFFGANGRRFSTNDNDQDENTFMNCAQFRMVGPWWHPKSCSDVGLNG-YFQ 414
            |..:....|.......:||||.|.|.||:: .|||.....|.|:|  ||....||| ||:
  Fly   139 GKYSGTAGDSLRYHINKRFSTFDRDNDESS-KNCAAEHGGGWWFH--SCLSSSLNGLYFR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ensh-1NP_001024508.1 FBG 220..460 CDD:214548 60/190 (32%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 60/190 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14144
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.100

Return to query results.
Submit another query.