DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hlh-8 and CG33557

DIOPT Version :9

Sequence 1:NP_509367.1 Gene:hlh-8 / 181069 WormBaseID:WBGene00001953 Length:178 Species:Caenorhabditis elegans
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:63 Identity:26/63 - (41%)
Similarity:37/63 - (58%) Gaps:6/63 - (9%)


- Green bases have known domain annotations that are detailed below.


 Worm    26 NRRERQRTKELNDAFTLLRKLIPSMPSD-KMSKIHTLRIATDYISFLDEMQKNG-----CKLY 82
            |.|||.||..:|.|:..||.|||:.|.: |:|||..:|:|:.||:.|....:.|     |.|:
  Fly    67 NARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTECQPCLLH 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hlh-8NP_509367.1 HLH 21..71 CDD:278439 22/45 (49%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.