Sequence 1: | NP_509335.1 | Gene: | zig-4 / 181051 | WormBaseID: | WBGene00006981 | Length: | 253 | Species: | Caenorhabditis elegans |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 246 | Identity: | 52/246 - (21%) |
---|---|---|---|
Similarity: | 94/246 - (38%) | Gaps: | 52/246 - (21%) |
- Green bases have known domain annotations that are detailed below.
Worm 14 INAHPPMHAEMHSAVVTLANEIDTNYLTSPAKIKIVAPLESALIPGGETYQLRCDIMSTPAATIH 78
Worm 79 WKFNGKLIQGSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNG---HQTIE 140
Worm 141 TVAEVEIEGEASGCRSNHKSAPEIVFWTDSRF--EMTGNVATLVC--RANQQVDWVWMSNDELVK 201
Worm 202 NNDKF-------TVLSNGDLVIKNIVWDDMGTYTCIARNQFGEARQETFLY 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
zig-4 | NP_509335.1 | I-set | 47..147 | CDD:254352 | 21/102 (21%) |
Ig | 65..144 | CDD:143165 | 19/81 (23%) | ||
IG_like | 176..245 | CDD:214653 | 19/77 (25%) | ||
Ig | <193..238 | CDD:299845 | 14/51 (27%) | ||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 3/15 (20%) |
Ig | 145..238 | CDD:416386 | 23/115 (20%) | ||
Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
Ig strand A' | 154..159 | CDD:409353 | 2/13 (15%) | ||
Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 178..183 | CDD:409353 | 2/9 (22%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 0/7 (0%) | ||
Ig | 242..333 | CDD:416386 | 22/92 (24%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 272..277 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 295..305 | CDD:409353 | 1/9 (11%) | ||
Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 325..334 | CDD:409353 | 2/8 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |