DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DR1 and Chrac-14

DIOPT Version :10

Sequence 1:NP_001929.1 Gene:DR1 / 1810 HGNCID:3017 Length:176 Species:Homo sapiens
Sequence 2:NP_476646.2 Gene:Chrac-14 / 3772329 FlyBaseID:FBgn0043002 Length:128 Species:Drosophila melanogaster


Alignment Length:105 Identity:30/105 - (28%)
Similarity:58/105 - (55%) Gaps:3/105 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     9 DDLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVI 72
            :||.:|.|.|.::|||.|| :..|:.:||..:....:.|...::|.:..:.:|...|||:.:.::
  Fly     6 EDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDIL 70

Human    73 QALESLGFGSYISEVKEVLQECKTVALKRR--KASSRLEN 110
            |.|..|.|.|::..:.:.|:..:.|..:::  |||.:..|
  Fly    71 QTLTELDFESFVPSLTQDLEVYRKVVKEKKESKASKKDSN 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DR1NP_001929.1 HFD_Dr1 8..130 CDD:467030 30/105 (29%)
Nuclear localization signal. /evidence=ECO:0000255 100..103 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176
Chrac-14NP_476646.2 HFD_POLE3_DPB4 6..92 CDD:467053 25/85 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.