DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rig-3 and DIP-delta

DIOPT Version :9

Sequence 1:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:409 Identity:75/409 - (18%)
Similarity:129/409 - (31%) Gaps:156/409 - (38%)


- Green bases have known domain annotations that are detailed below.


 Worm    35 IVISSEAMDYDT--NTITVREGKKLMVSCVFESDEQIHKSD------LLWKQANGNNIDGESNPS 91
            :|:....:|.::  :::.|||.:.:.::|         ::|      ::|::.:|..|       
  Fly   141 VVVPPNILDIESTPSSVAVRENQNINMTC---------RADGFPAPKIIWRREDGEEI------- 189

 Worm    92 LFSVILNEKGSKHRKTSLHFSSVHTRDTGLYTCTGRTAGGENFEKTIKLVVLPAIEWNDKDTVKG 156
              :|...:|...:....|..:.|...:.|.|.|........:..|.|.|    .:|::....|..
  Fly   190 --AVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIIL----DVEFSPMIWVPN 248

 Worm   157 ALLGEPITIDCGVKGPSGKEPMIQMTNGNGEPLDEEIWTIAGNEATIDSLKKEHAELTVSCITIE 221
            .|:|.|                                  :|.:.|||            |.| |
  Fly   249 QLVGAP----------------------------------SGTDVTID------------CHT-E 266

 Worm   222 MHQETSKEEFPVVDRKDVNIEVYTLPEFETEESVQYTVIDNHVRDAIIY--CNVTHSFPPVRHYT 284
            .|.:                                         ||||  .|.....|..::.|
  Fly   267 AHPK-----------------------------------------AIIYWVYNSVMVLPSKKYKT 290

 Worm   285 FYHGDEEIKMSDKFNIFVNVGVSQGAHLK--IHNVNENDLGTYKCEANNIKAKSYHTIHLREANA 347
            .|..:                 |..||:|  |.|:...|.|.|:|.:.|...::..:|.:.|...
  Fly   291 DYTEN-----------------SYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPL 338

 Worm   348 PAEPKV----TLIEDKRHSIIWK-----VESIDRDPDLPMTAVEIRHLRAGTAEASGVSDEDISD 403
            |:.|..    |.:|.:.::||..     .:|:..|....|.    ..|..|:|.:|  |....|.
  Fly   339 PSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMK----NDLYPGSASSS--SSGGSSS 397

 Worm   404 AYWKSHSIFMQRNIKDDGI 422
            |  .|.|..||.:....|:
  Fly   398 A--ASSSSSMQTSALPGGV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rig-3NP_509155.1 IG_like 48..142 CDD:214653 18/99 (18%)
Ig 267..341 CDD:319273 19/77 (25%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 0/1 (0%)
Ig 145..238 CDD:416386 19/114 (17%)
Ig strand A 145..149 CDD:409353 0/3 (0%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/15 (7%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 3/11 (27%)
Ig 242..333 CDD:416386 32/195 (16%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 5/19 (26%)
Ig strand C 272..277 CDD:409353 3/4 (75%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 4/26 (15%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 1/8 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.