DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nkx3-1 and bap

DIOPT Version :9

Sequence 1:NP_035051.1 Gene:Nkx3-1 / 18095 MGIID:97352 Length:237 Species:Mus musculus
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:319 Identity:100/319 - (31%)
Similarity:132/319 - (41%) Gaps:118/319 - (36%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 VEAGGRSPWAAPPTQSKRLTS-FLIQDILRDRAERHGGHSGNPQHSPDPRR----DSAPEPDKA- 70
            :|:.|.|  ||....||.||: |.|.|||             .:.:|:.||    ||.|||:|. 
  Fly     4 MESAGVS--AAMAGLSKSLTTPFSINDIL-------------TRSNPETRRMSSVDSEPEPEKLK 53

Mouse    71 ----GGRGVAPEDP------------------PSIR-------------------HSPAETPTEP 94
                ..|.::...|                  ||.|                   |....|....
  Fly    54 PSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSS 118

Mouse    95 ESD------AHFETYL---LD---CEHNPGDLASAPQVTKQP--------------QKRSRAAFS 133
            .:|      |:|.:.|   ||   |..|..|..|.|.::..|              :||||||||
  Fly   119 AADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFS 183

Mouse   134 HTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSEDLGVL---EKN 195
            |.||.||||:|:.|:|||.|||:.:||:|:|||||||||||||||||||||:.:....|   .|.
  Fly   184 HAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKR 248

Mouse   196 SPLSLPALKDDSLP-------------STSLVSVYT--------SYPY------YPYLY 227
            .|:.:...:|.|..             ..:|:::|.        ..|.      :||.|
  Fly   249 VPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nkx3-1NP_035051.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 30/130 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..130 8/35 (23%)
Homeobox 128..181 CDD:278475 40/52 (77%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 40/52 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003099
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4480
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.