DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nkx2-5 and scro

DIOPT Version :9

Sequence 1:NP_032726.1 Gene:Nkx2-5 / 18091 MGIID:97350 Length:318 Species:Mus musculus
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:373 Identity:122/373 - (32%)
Similarity:163/373 - (43%) Gaps:82/373 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    10 TPFSVKDILN-LEQQQRSLASGDLSARLEATLAPASCMLAAFKPEAYSGPEAAASGLAELRAEMG 73
            |||||.|||: :|:..|         :||....|.|...:.....:.:.|....:........||
  Fly   114 TPFSVTDILSPIEESYR---------KLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMG 169

Mouse    74 PAPSPP----KCSPAFPAAPTFYPGAYGD--------PDPAKDPRADKKELCA------------ 114
            .....|    .|.|....:   ..|.|.|        ...|.|||.....|.:            
  Fly   170 TLYHSPGVQTYCGPTDNLS---LAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGN 231

Mouse   115 LQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTST 179
            :........:::...:.|.|:||:: ||||:||||||||||||||||||||||:.|||::.||.|
  Fly   232 MSGLAACSVSDSKPLQFPLAQRRKR-RVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPT 295

Mouse   180 QVKIWFQNRRYKCKRQRQDQTLELLGPPPPPA---RRIAVPVLVRDGKPCLG-DPAAYAPAYGVG 240
            ||||||||.|||||||.:::.:........||   ||:||||||:|||||.| :.::.:..:|..
  Fly   296 QVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGTN 360

Mouse   241 LNAYGYNAYPYPSYGGAACSPGYSCAAYPA---------APPAAQPPAASANSNFVNFG-VGDLN 295
            ..:.|.|.  ..:..|.|.|...|..|..:         ||.:..|..:|  |...::| ||..|
  Fly   361 STSAGNNT--GSANNGNANSGIVSVTANVSGGLNLITGDAPNSHSPDTSS--SLLASYGTVGGSN 421

Mouse   296 T--VQSP-----------------------GMPQGNSGVSTLHGIRAW 318
            .  :|.|                       |..|...|...|.| |||
  Fly   422 VAMLQQPCNNTLMSNSLAMAYRNQNNFISNGHQQQCGGYLPLQG-RAW 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nkx2-5NP_032726.1 Homeobox 144..194 CDD:365835 41/49 (84%)
scroNP_001015473.1 Homeobox 256..309 CDD:278475 43/53 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.