DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nkx2-5 and vnd

DIOPT Version :9

Sequence 1:NP_032726.1 Gene:Nkx2-5 / 18091 MGIID:97350 Length:318 Species:Mus musculus
Sequence 2:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster


Alignment Length:203 Identity:79/203 - (38%)
Similarity:102/203 - (50%) Gaps:63/203 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse   120 ELDKAETDGAERPRA-----RRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTST 179
            ::|.|:..|......     .::||.||||::||.|||||||:||||||||||:.|||:::||.|
  Fly   523 DVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPT 587

Mouse   180 QVKIWFQNRRYKCKRQRQDQTLELLGPPP---------------PPARRIAVPVLVRDGKPCLGD 229
            ||||||||.|||.||.:.::..|  |.|.               |..||:|||||||:|||||||
  Fly   588 QVKIWFQNHRYKTKRAQNEKGYE--GHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGD 650

Mouse   230 --------------------------------PAAY--APAYGVGLNAYGY-------NAYPYPS 253
                                            .|||  |.|...||:|:.:       :.:|:..
  Fly   651 SSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAAAGLHAHAHAHAHAHGHGHPHAH 715

Mouse   254 YGGAACSP 261
            ...||..|
  Fly   716 AQRAAWWP 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nkx2-5NP_032726.1 Homeobox 144..194 CDD:365835 37/49 (76%)
vndNP_476786.2 Homeobox 548..601 CDD:278475 40/52 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.