DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nkx2-3 and bap

DIOPT Version :9

Sequence 1:NP_032725.1 Gene:Nkx2-3 / 18089 MGIID:97348 Length:362 Species:Mus musculus
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:283 Identity:88/283 - (31%)
Similarity:121/283 - (42%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 STPFSVKDILNLE--QQRHFHGAHLQAE---------LEQHFHSAPCMLATAEGTQFSDAGEEDE 62
            :||||:.|||...  :.|.......:.|         .|:....:|.:.....|.......:|.:
  Fly    21 TTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQ 85

Mouse    63 EEEGEKLSYLNSLAAA--------EGHGDSGLCPQSYVHTVLR---DACSGPKEQEEEVVSERSQ 116
            ....:..:||...|||        :..|.|......|:...|.   ...:.|.:...   ...:.
  Fly    86 PSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRR---CTSND 147

Mouse   117 KSCQLKKSLEAA-GDCKTSEDGERPKPRSRRK-PRVLFSQAQVFELERRFKQQRYLSAPEREHLA 179
            ..|.....|.:: .:...|.||   ...||:| .|..||.||||||||||.||||||.|||..:|
  Fly   148 SDCDSPPPLSSSPSESPLSHDG---SGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMA 209

Mouse   180 SSLKLTSTQVKIWFQNRRYKCKRQ--RQDKSLELGTHAPPPPPRRVAVPVLVRDGKPCVTPSAQT 242
            .||:||.|||||||||||||.||:  :|.::..||.      .:||.|.||||:.          
  Fly   210 KSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGA------SKRVPVQVLVRED---------- 258

Mouse   243 YGSPYGVGAGAYSYNSFPAYGYG 265
                   |:..|::.:.|..|:|
  Fly   259 -------GSTTYAHMAAPGAGHG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nkx2-3NP_032725.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..149 6/24 (25%)
HOX 145..201 CDD:197696 42/56 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..222 3/20 (15%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 40/52 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.