DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nkx2-2 and bap

DIOPT Version :9

Sequence 1:NP_035049.1 Gene:Nkx2-2 / 18088 MGIID:97347 Length:273 Species:Mus musculus
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:313 Identity:104/313 - (33%)
Similarity:133/313 - (42%) Gaps:64/313 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 SLTNTKTGFSVKDIL--DLPDTNDEDGSVAEGPEEE-----SEGPEPAKRAGPLGQGALDAVQSL 59
            |||   |.||:.|||  ..|:|. ...||...||.|     |:......::.||....| .:..|
  Fly    19 SLT---TPFSINDILTRSNPETR-RMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDL-GLYKL 78

Mouse    60 PLKSPFYDSSDNP--YTRWLA-------------------STEGLQYSL--HGLAASAP------ 95
            ........|:..|  |.::.|                   :.:.:|..|  .|...:||      
  Fly    79 TQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRC 143

Mouse    96 -PQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPERE 159
             ..||...|| |....||.....:..|.|.:.|||. |..||.||.:||||||.||||||.|||.
  Fly   144 TSNDSDCDSP-PPLSSSPSESPLSHDGSGLSRKKRS-RAAFSHAQVFELERRFAQQRYLSGPERS 206

Mouse   160 HLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVR-DGKPCHALKAQDL 223
            .:|..:|||.|||||||||.|||.||.:.:: .|...|.:.:||.|.|||| ||...:|    .:
  Fly   207 EMAKSLRLTETQVKIWFQNRRYKTKRKQIQQ-HEAALLGASKRVPVQVLVREDGSTTYA----HM 266

Mouse   224 AAATFQAGIPFS-----------AYSAQSLQHMQYNAQYSSASTPQYPTAHPL 265
            ||.....|:..:           ||....|..||....|   ..||:....|:
  Fly   267 AAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPY---FYPQHKVPQPI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nkx2-2NP_035049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 20/60 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..131 14/46 (30%)
Homeobox 131..185 CDD:395001 36/53 (68%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.