DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPYSL2 and CG6106

DIOPT Version :9

Sequence 1:NP_001184222.1 Gene:DPYSL2 / 1808 HGNCID:3014 Length:677 Species:Homo sapiens
Sequence 2:NP_001285403.1 Gene:CG6106 / 32816 FlyBaseID:FBgn0030914 Length:486 Species:Drosophila melanogaster


Alignment Length:520 Identity:128/520 - (24%)
Similarity:199/520 - (38%) Gaps:127/520 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   115 INDQSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKT----IEAHS------RM 169
            :.|.|...||.||.||:           .:|:|:::   |..|..|.|    .|:.|      .:
  Fly    12 LGDGSQNALIHGGIIVD-----------TEGIIRRV---LRSPQEVNTYLYNTESESVYDFGDLV 62

Human   170 VIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVV-PEPGTSLLAAFDQWREWAD 233
            ::||.||.:.....|  |....:.|...||||.|||.|.|||... .:|.|..:|........|.
  Fly    63 LMPGLIDPNVHINEP--GRKDWEGFATATKAAAAGGFTTIIDRPTNAQPPTVSVAHLKAKTSTAR 125

Human   234 SKSCCDYSLHVDISEWH---KGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDC----------- 284
            .|      ::||:..|.   .|..:::.||: ..||..          .|.|.|           
  Fly   126 GK------IYVDVGFWGGLVPGNGDQLAALL-GAGVMG----------LQCTLCDPAAPVSQEFP 173

Human   285 -----QIYEVLSVI-RDIG---AIAQVHAE---NGDIIAEEQQRILDLGITGPEGH---VLSRPE 334
                 |:.|.||.: :|..   ||..||||   ..:|..:|:         .|..:   :::||.
  Fly   174 AVNESQLEEALSQLDKDQAEGEAIVAVHAELPLTTEIHPDEE---------APREYGTFLVTRPP 229

Human   335 EVEAEAVNRAITIANQ--TNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDG-SHYW 396
            ::|..|......:||:  ..| ::|....|..|..::.:.|::|         .:|..|. .|| 
  Fly   230 QMEISATQLLCRLANRHPRRC-IHILNCSSGESLPLVEECRRQG---------GNLTVDTCPHY- 283

Human   397 SKNWAKAA--------AFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAV----G 449
               .|.||        .|.|.||:...........:|...|.:::.||.|.......:|:    |
  Fly   284 ---LALAAEDVPDCGTEFKTWPPIRERRNQEQLWQALRPGGAIRMIGSDHSPATPGARALTCGRG 345

Human   450 KDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVA----VTSTNAAKVFNLYPRKGRIAVGS 510
            :.||.....|.|..:..:||:| .|....:...|..:|    :.....|.:..|...|||||.|.
  Fly   346 RGNFLKAWPGINSLQLSLSVVW-TAAANRRGSANLTIADIHRLMCQEPANLCGLSASKGRIAEGY 409

Human   511 DADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHV---TEGSGR 572
            |||..:|.|:...|:..:...::.:...:.|.:.||.....:.:|        |||   .||.|:
  Fly   410 DADFCVWSPEEEFTVGPELLYTATKATPYAGQKLRGVVHATVVRG--------LHVYQQFEGFGQ 466

Human   573  572
              Fly   467  466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPYSL2NP_001184222.1 D-HYD 122..571 CDD:238639 125/510 (25%)
CG6106NP_001285403.1 L-HYD_ALN 2..473 CDD:238640 128/520 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D719800at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.