DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment T07F12.2 and Pradc1

DIOPT Version :9

Sequence 1:NP_508831.3 Gene:T07F12.2 / 180762 WormBaseID:WBGene00020322 Length:289 Species:Caenorhabditis elegans
Sequence 2:NP_001156899.1 Gene:Pradc1 / 73327 MGIID:1920577 Length:188 Species:Mus musculus


Alignment Length:169 Identity:44/169 - (26%)
Similarity:71/169 - (42%) Gaps:11/169 - (6%)


- Green bases have known domain annotations that are detailed below.


 Worm   117 DNMLFTVTEPYTLAYTYQMKHAFMLGVHFPDGANKTFRNLEMVLADPVHGCEALRNEIF-APSVI 180
            |.:.|.|..|..:.|.:....|...|..|    :..:..:.:|.|:|...|..|.|..| ...:.
Mouse    28 DYLYFQVLSPGDIRYIFTATPAKDFGGIF----HTRYEQIHLVPAEPPEACGELSNGFFIQDQIA 88

 Worm   181 LMERGECSFTVKALNGEKAGATVIMVTDSQNYEYSYHQYYVNMIPDESLDRANVPCVYVAPVTGR 245
            |:|||.|||..|....::.|...::::|:   ......:||.||.|.:...|::|.:::....|.
Mouse    89 LVERGGCSFLSKTRVVQEHGGRAVIISDN---AVDNDSFYVEMIQDSTQRTADIPALFLLGRDGY 150

 Worm   246 YFRDHLEEGGT--IKLDIPVERNYAPWVHHQKKAPWEIW 282
            ..|..||:.|.  ..:.|||.....| .....:.||..|
Mouse   151 MIRRSLEQHGLPWAIISIPVNVTSIP-TFELLQPPWTFW 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
T07F12.2NP_508831.3 Peptidases_S8_S53 140..263 CDD:299169 32/125 (26%)
Pradc1NP_001156899.1 PA_hPAP21_like 51..168 CDD:239042 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C163585617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3920
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4538
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008512
OrthoInspector 1 1.000 - - oto26289
orthoMCL 1 0.900 - - OOG6_108714
Panther 1 1.100 - - LDO PTHR22702
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3906
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.