Sequence 1: | NP_508831.3 | Gene: | T07F12.2 / 180762 | WormBaseID: | WBGene00020322 | Length: | 289 | Species: | Caenorhabditis elegans |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003200881.1 | Gene: | si:ch211-282j22.3 / 562939 | ZFINID: | ZDB-GENE-091113-49 | Length: | 837 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 49/200 - (24%) |
---|---|---|---|
Similarity: | 77/200 - (38%) | Gaps: | 32/200 - (16%) |
- Green bases have known domain annotations that are detailed below.
Worm 75 LPADSTFSGKMKPRGWLLFSFLLIIQVAYAKIPREYEEVENQDNMLFTVTEPYTLAYTYQMKHAF 139
Worm 140 MLGV------HFPDGANKTFRNLEMVLADPVHGCEALRNEI-FAPSVILMERGECSFTVKALNGE 197
Worm 198 KAGATVIMVTDSQNYEYSYHQYYVNMIPD-ESLDRANVPCVYVAPVTGRYFRDHLEEGGTIK-LD 260
Worm 261 IPVER 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
T07F12.2 | NP_508831.3 | Peptidases_S8_S53 | 140..263 | CDD:299169 | 31/131 (24%) |
si:ch211-282j22.3 | XP_003200881.1 | Glyco_hydro_47 | 55..494 | CDD:279825 | |
PA_EDEM3_like | 642..768 | CDD:239041 | 31/133 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |