DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment T07F12.2 and si:ch211-282j22.3

DIOPT Version :9

Sequence 1:NP_508831.3 Gene:T07F12.2 / 180762 WormBaseID:WBGene00020322 Length:289 Species:Caenorhabditis elegans
Sequence 2:XP_003200881.1 Gene:si:ch211-282j22.3 / 562939 ZFINID:ZDB-GENE-091113-49 Length:837 Species:Danio rerio


Alignment Length:200 Identity:49/200 - (24%)
Similarity:77/200 - (38%) Gaps:32/200 - (16%)


- Green bases have known domain annotations that are detailed below.


 Worm    75 LPADSTFSGKMKPRGWLLFSFLLIIQVAYAKIPREYEEVENQDNMLFTVTEPYTLAYTYQMKHAF 139
            :|.||       .:|  :|...|:.:|:...   |:|||.   .::..:..|..|..|..|....
Zfish   597 VPQDS-------QKG--VFKLKLVAEVSQTP---EHEEVV---PLIVQLISPPFLGRTVLMAGPA 646

 Worm   140 MLGV------HFPDGANKTFRNLEMVLADPVHGCEALRNEI-FAPSVILMERGECSFTVKALNGE 197
            ..|:      |...|     |.::.|   |...|..:.|.: ....:.|..||:|.|..||...:
Zfish   647 KFGLDLTKQEHGVKG-----RIMKSV---PYTACGPIENTVELQGHIALALRGDCMFAAKARRLQ 703

 Worm   198 KAGATVIMVTDSQNYEYSYHQYYVNMIPD-ESLDRANVPCVYVAPVTGRYFRDHLEEGGTIK-LD 260
            :|||..::..|.:....|.......|:.| |..|...||.|::....|......|:|...:. |.
Zfish   704 EAGAIGVIFIDHREGSSSAETPLFQMVGDGEPTDDITVPLVFLFSKEGATLTAALQEHHNVDVLL 768

 Worm   261 IPVER 265
            :|.||
Zfish   769 LPKER 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
T07F12.2NP_508831.3 Peptidases_S8_S53 140..263 CDD:299169 31/131 (24%)
si:ch211-282j22.3XP_003200881.1 Glyco_hydro_47 55..494 CDD:279825
PA_EDEM3_like 642..768 CDD:239041 31/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.