DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment T07F12.2 and edem3

DIOPT Version :9

Sequence 1:NP_508831.3 Gene:T07F12.2 / 180762 WormBaseID:WBGene00020322 Length:289 Species:Caenorhabditis elegans
Sequence 2:XP_005166989.2 Gene:edem3 / 559811 ZFINID:ZDB-GENE-070801-5 Length:888 Species:Danio rerio


Alignment Length:98 Identity:30/98 - (30%)
Similarity:48/98 - (48%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


 Worm   158 MVLADPVHGCEALRN-EIFAPSVILMERGECSFTVKALNGEKAGATVIMVTDSQNYEYSYHQYYV 221
            :.:|:|.:||..|.| ||.|..:.|::||:|.|..||.:.:||||...:|.|......|......
Zfish   665 VTVAEPYNGCSELSNGEIVAGRIALLQRGQCMFAEKARHVQKAGAIGGIVIDDNEGSSSDTAPLF 729

 Worm   222 NMIPD-ESLDRANVPCVYVAPVTGRYFRDHLEE 253
            .|..| .:.|...:|.:::....|....:.|:|
Zfish   730 QMAGDGRNTDDVTLPLLFLFHKEGNILLEALKE 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
T07F12.2NP_508831.3 Peptidases_S8_S53 140..263 CDD:299169 30/98 (31%)
edem3XP_005166989.2 Glyco_hydro_47 44..482 CDD:307602
PA_EDEM3_like 644..770 CDD:239041 30/98 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.