DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment T07F12.2 and znrf3

DIOPT Version :9

Sequence 1:NP_508831.3 Gene:T07F12.2 / 180762 WormBaseID:WBGene00020322 Length:289 Species:Caenorhabditis elegans
Sequence 2:NP_001295484.1 Gene:znrf3 / 556813 ZFINID:ZDB-GENE-070705-263 Length:866 Species:Danio rerio


Alignment Length:159 Identity:41/159 - (25%)
Similarity:65/159 - (40%) Gaps:33/159 - (20%)


- Green bases have known domain annotations that are detailed below.


 Worm    90 WLLFSFLLIIQVAYAKIPREYEEVENQDNMLFTVTEPYTLAYTYQMKHAFMLGVHFPDGANKTFR 154
            |:|.| :|....|:.::.. :|...|.|         || .||..::..|...     ||..:..
Zfish    22 WVLGS-VLAKDTAFVEVVL-FESSPNGD---------YT-TYTTGLQGRFSRA-----GATISAE 69

 Worm   155 NLEMVLADPVHGC----EALRNEIFAPSVILMERGECS---FTV--KALNGEKAGATVIMVTDSQ 210
            . |:|...|:..|    |....|.....|:.:|:.|..   .||  ||....:.|||.::...|:
Zfish    70 G-EIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPSCLTVLGKAKRAVQRGATAVIFDVSE 133

 Worm   211 NYEYSYHQYYVNMIPDESLDRANVPCVYV 239
            |.: :..|  :|.:.::.|.|   |.|||
Zfish   134 NPD-AIDQ--LNQVSEDPLKR---PVVYV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
T07F12.2NP_508831.3 Peptidases_S8_S53 140..263 CDD:299169 28/109 (26%)
znrf3NP_001295484.1 zf-RING_2 265..306 CDD:290367
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.