DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment T07F12.2 and CG9849

DIOPT Version :9

Sequence 1:NP_508831.3 Gene:T07F12.2 / 180762 WormBaseID:WBGene00020322 Length:289 Species:Caenorhabditis elegans
Sequence 2:NP_001188993.1 Gene:CG9849 / 37647 FlyBaseID:FBgn0034803 Length:196 Species:Drosophila melanogaster


Alignment Length:205 Identity:57/205 - (27%)
Similarity:93/205 - (45%) Gaps:25/205 - (12%)


- Green bases have known domain annotations that are detailed below.


 Worm    90 WLLFSFLLIIQVAYA---KIPREYEEVENQD----NMLFTVTEPYTLAYTYQMKHAFMLGVHFPD 147
            ||:.:..|...:..:   .||     :..||    ::.|.:..|..|.|||:::.|...|..|  
  Fly     5 WLVLAATLSRSIRASTTISIP-----ITTQDIIAGDVFFEILSPSELEYTYRLRPAKDFGSAF-- 62

 Worm   148 GANKTFRNLEMVLADPVHGCEALRN-EIFAPSVILMERGECSFTVKALNGEKAGATVIMVTDSQN 211
              ::....:.:|:.||...|:.:|| ......|.|::||||||..|.|..|.|||...::|: .|
  Fly    63 --SERLEGVPLVITDPPGACQEIRNARDLNGGVALIDRGECSFLTKTLRAEAAGALAAIITE-YN 124

 Worm   212 YEYSYHQYYVNMIPDESLDRANVPCVYVAPVTGRYFRDHLEEGGTIK--LDIPVERNYAP--WVH 272
            ......::|:.||.|.|...||:|..::....|...|..|:....:.  ::|||...:.|  .::
  Fly   125 PSSPEFEHYIEMIHDNSQQDANIPAGFLLGKNGVIIRSTLQRLKRVHALINIPVNLTFTPPSKIN 189

 Worm   273 HQKKAPWEIW 282
            |   .||..|
  Fly   190 H---PPWLGW 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
T07F12.2NP_508831.3 Peptidases_S8_S53 140..263 CDD:299169 36/125 (29%)
CG9849NP_001188993.1 PA_hPAP21_like 57..176 CDD:239042 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3920
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3871
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1302890at2759
OrthoFinder 1 1.000 - - FOG0008512
OrthoInspector 1 1.000 - - oto20480
orthoMCL 1 0.900 - - OOG6_108714
Panther 1 1.100 - - LDO PTHR22702
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3906
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.