DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment T07F12.2 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_508831.3 Gene:T07F12.2 / 180762 WormBaseID:WBGene00020322 Length:289 Species:Caenorhabditis elegans
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:153 Identity:31/153 - (20%)
Similarity:62/153 - (40%) Gaps:52/153 - (33%)


- Green bases have known domain annotations that are detailed below.


 Worm   140 MLGVHFPDGANKTFRNLEMV--LADPVHGCEALRNEIFA------------------------PS 178
            :.|.||.:.:..|..||.:.  ..:.:.||.. ||:..|                        ||
pombe    62 VFGKHFTNASATTVINLYLPSNFQEDMSGCPN-RNDTDASYFYENDIIDYDIEYIEQKSYSSKPS 125

 Worm   179 V------------------ILMERGECSFTVKALNGEKAGATVIMVTDSQNYEYSYHQYYVNMIP 225
            .                  :|::||:|::..|||..::.|...::|.|::: ..|:..:|  |:.
pombe   126 ARVQKDDGGESKDEAILDFLLVQRGKCTYFDKALEAQRLGFKGVIVGDNRS-PSSFRLHY--MVA 187

 Worm   226 DESLD--RANVPCVYVAPVTGRY 246
            .:.:|  :.::|.::|:  |..|
pombe   188 PDKVDESKVHIPSLFVS--TSSY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
T07F12.2NP_508831.3 Peptidases_S8_S53 140..263 CDD:299169 31/153 (20%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 31/153 (20%)
Peptidases_S8_S53 <144..211 CDD:299169 18/70 (26%)
zf-RING_2 320..362 CDD:290367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.