DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment T07F12.2 and dsc1

DIOPT Version :9

Sequence 1:NP_508831.3 Gene:T07F12.2 / 180762 WormBaseID:WBGene00020322 Length:289 Species:Caenorhabditis elegans
Sequence 2:NP_595266.2 Gene:dsc1 / 2541251 PomBaseID:SPBC947.10 Length:695 Species:Schizosaccharomyces pombe


Alignment Length:254 Identity:51/254 - (20%)
Similarity:89/254 - (35%) Gaps:91/254 - (35%)


- Green bases have known domain annotations that are detailed below.


 Worm    45 ACVCVPVHFPVTVFAHSAFLVLYAVFTAWFLPADSTFSGKMKPRGW-LLFSFLLIIQVAYAK--- 105
            :.||:..:|.:.|...::   ||:.|                   | :::.|..|..:.:..   
pombe   481 SAVCLRFYFIILVVCIAS---LYSAF-------------------WPVIYRFYFISALIFTSYSF 523

 Worm   106 -IPREYEEVENQDNMLFTVTEPYTLAYTYQMKHAFMLGVHFPDGANKTFRNLEMVLADPVHGCEA 169
             ||:..:.|:...:..||.|  |.|.       |.:|.::.|   ...|.:.|::|..|      
pombe   524 WIPQIIQNVKQGTSRSFTWT--YILG-------ASVLRLYLP---LAIFIDSELILGFP------ 570

 Worm   170 LRNEIFAPSVILMERGECSFTVKALNGEKAGATVIMVTDS-------------QNYEYSYHQYYV 221
             ....||..::|.    ..|.|          .|::|.|:             .:..|.||.   
pombe   571 -PKYFFALGLVLW----MLFQV----------LVLLVQDTLGPRFFLPKKFFLSSPVYDYHP--- 617

 Worm   222 NMIPDESLDR----ANVPCVYVAPVTGRYFRDHLEEGGTIK-LDIPVERNY--APWVHH 273
             :|..:.|:.    |||..:.:.|:      :.:..|.|:. ..:.|.|||  .| .||
pombe   618 -VIQQDDLEAFMRDANVCPICMQPI------ELVSTGSTLNPASMMVRRNYMLTP-CHH 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
T07F12.2NP_508831.3 Peptidases_S8_S53 140..263 CDD:299169 25/140 (18%)
dsc1NP_595266.2 zf-RING_2 632..689 CDD:290367 12/44 (27%)
zf-rbx1 <633..689 CDD:289448 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.