DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment T07F12.2 and rnf139

DIOPT Version :9

Sequence 1:NP_508831.3 Gene:T07F12.2 / 180762 WormBaseID:WBGene00020322 Length:289 Species:Caenorhabditis elegans
Sequence 2:NP_001116520.1 Gene:rnf139 / 100144552 ZFINID:ZDB-GENE-080401-4 Length:664 Species:Danio rerio


Alignment Length:315 Identity:66/315 - (20%)
Similarity:99/315 - (31%) Gaps:125/315 - (39%)


- Green bases have known domain annotations that are detailed below.


 Worm     3 NLPLHQIDFLFFIHNSFSDMQLRSVGNESAHSTRKCDCVKGCACVCVPVHFPVTVFAHSAFLVLY 67
            |:.|.....|.||| ..:|..|.|:......|.|:              |.||       .||..
Zfish   345 NMCLLLTAILHFIH-GMTDPVLMSLSASHVSSVRR--------------HVPV-------LLVSL 387

 Worm    68 AVFTAWFLPADSTFSGKMKPRGWLLFSFLLIIQVAYAKIPREYEEVENQDNMLFTVTEPYTLAYT 132
            .:||   ||              :|.||||....|.             :..||.||     |:.
Zfish   388 VLFT---LP--------------VLLSFLLWHHYAL-------------NTWLFAVT-----AFC 417

 Worm   133 YQ--MKHAFMLGVH---FPDGANKTFRN-LEMVLADPVHGCEALRNEI-FAPSVILMERGECSFT 190
            .:  :|....|.|:   ..||    |.| |...|.|.|:...:..|.| |...||:...|  ::|
Zfish   418 IELCLKVLVSLTVYALFMMDG----FYNVLWEKLDDYVYYVRSTGNVIEFIFGVIMFGNG--AYT 476

 Worm   191 VKALNGEKAGATVIMVTDSQNYEYSYHQYY-------------------VNMIPDESLDRANVPC 236
            :...:|.|..|.::.:       ::|...|                   :|.:|:          
Zfish   477 MMFESGSKIRACMMCL-------HAYFNIYLQAKNGWKTFINRRTAVKKINSLPE---------- 524

 Worm   237 VYVAPVTGRYFRD--------HLEEGGTIKLDIPVERNY-----APWVHHQKKAP 278
                 |.|...||        :.|.|.:.:: .|....:     ..|::.|...|
Zfish   525 -----VRGSRLRDIEDVCAICYQEFGSSARI-TPCSHYFHALCLRKWLYIQDTCP 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
T07F12.2NP_508831.3 Peptidases_S8_S53 140..263 CDD:299169 30/154 (19%)
rnf139NP_001116520.1 TRC8_N 13..506 CDD:290425 54/230 (23%)
zf-rbx1 516..576 CDD:289448 12/74 (16%)
RING 537..579 CDD:238093 6/38 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.