DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nhlh2 and HLH4C

DIOPT Version :9

Sequence 1:NP_848892.1 Gene:Nhlh2 / 18072 MGIID:97324 Length:135 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:72 Identity:64/72 - (88%)
Similarity:71/72 - (98%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    63 LSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYIS 127
            |||||:|||||||.|||:||||||||||||||::|||||||||||||||||||||||:||||||:
  Fly    94 LSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIA 158

Mouse   128 YLNHVLD 134
            ||||||:
  Fly   159 YLNHVLE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nhlh2NP_848892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81 15/17 (88%)
bHLH_TS_HEN2 63..135 CDD:381545 64/72 (89%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 51/56 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7239
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004393
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109092
Panther 1 1.100 - - O PTHR13864
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3713
SonicParanoid 1 1.000 - - X3111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.