powered by:
Protein Alignment Nhlh2 and HLH4C
DIOPT Version :9
Sequence 1: | NP_848892.1 |
Gene: | Nhlh2 / 18072 |
MGIID: | 97324 |
Length: | 135 |
Species: | Mus musculus |
Sequence 2: | NP_001259243.1 |
Gene: | HLH4C / 31397 |
FlyBaseID: | FBgn0011277 |
Length: | 191 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 64/72 - (88%) |
Similarity: | 71/72 - (98%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Mouse 63 LSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYIS 127
|||||:|||||||.|||:||||||||||||||::|||||||||||||||||||||||:||||||:
Fly 94 LSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIA 158
Mouse 128 YLNHVLD 134
||||||:
Fly 159 YLNHVLE 165
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
97 |
1.000 |
Domainoid score |
I7239 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004393 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_109092 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13864 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3713 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3111 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.940 |
|
Return to query results.
Submit another query.