DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nhlh2 and Fer1

DIOPT Version :9

Sequence 1:NP_848892.1 Gene:Nhlh2 / 18072 MGIID:97324 Length:135 Species:Mus musculus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:133 Identity:45/133 - (33%)
Similarity:65/133 - (48%) Gaps:23/133 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 SPDQAADSDHPSSTHSDPESLGGADTKVLGSVSDLEPVEEADGDGKGGSRAALYPHPQQLSREEK 68
            |.|.....:|  |:.||.|.    |....|..||.|..|:           ...|..:   |..|
  Fly    30 SSDYFFGDEH--SSESDDED----DAYSSGFNSDQENTEK-----------TFCPFSR---RSHK 74

Mouse    69 RRRRRAT---AKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLN 130
            .||.:..   |:.|.|...|||.|:::.|.||..||..:||||.:|:|||::.|:|||.||::|:
  Fly    75 PRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLS 139

Mouse   131 HVL 133
            .::
  Fly   140 EMV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nhlh2NP_848892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81 20/79 (25%)
bHLH_TS_HEN2 63..135 CDD:381545 31/74 (42%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.