DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nhlh1 and HLH4C

DIOPT Version :9

Sequence 1:NP_035046.1 Gene:Nhlh1 / 18071 MGIID:98481 Length:133 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:87 Identity:68/87 - (78%)
Similarity:77/87 - (88%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    46 RSSELGESGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKK 110
            |::.:......:|..|||||||||||||.||||||||||||||||||::||||||||||||||||
  Fly    79 RTTPIAHLDPSELVGLSREERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKK 143

Mouse   111 LSKIEILRLAICYISYLNHVLD 132
            |||||||:||||||:||||||:
  Fly   144 LSKIEILKLAICYIAYLNHVLE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nhlh1NP_035046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78 17/31 (55%)
HLH 77..127 CDD:306515 45/49 (92%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 52/56 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7239
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004393
OrthoInspector 1 1.000 - - oto92785
orthoMCL 1 0.900 - - OOG6_109092
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3713
SonicParanoid 1 1.000 - - X3111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.