DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igcm-4 and CG31431

DIOPT Version :9

Sequence 1:NP_508377.1 Gene:igcm-4 / 180518 WormBaseID:WBGene00022418 Length:541 Species:Caenorhabditis elegans
Sequence 2:NP_001247231.1 Gene:CG31431 / 326138 FlyBaseID:FBgn0051431 Length:361 Species:Drosophila melanogaster


Alignment Length:259 Identity:61/259 - (23%)
Similarity:103/259 - (39%) Gaps:57/259 - (22%)


- Green bases have known domain annotations that are detailed below.


 Worm   161 IKINTGGKLELRCPAQG-------NPLPEIRWYQNEMEISEKTHKHVSTI---TVEPVESS---- 211
            |:...|..::|:|..:|       |.: :|.||..  :.||.....:.::   |..|.|.|    
  Fly    41 IQQRAGFDVKLQCNLKGLVDESMLNDI-KIHWYFK--QCSENNCHQLGSVDEWTALPCEPSLCRP 102

 Worm   212 ----------HSGVYRCVVENPLGSLSFAFDVSVGDFFDPTTTEATEYQETAM---EPVIDQPYN 263
                      :||:|:|.:...:...:.|.||.:      ..|...:.:.|::   |.|...|.|
  Fly   103 ELWLRNVTERYSGLYKCSINPHIWDKAQAVDVQL------VRTYQLDVKNTSLAAPEFVDSYPNN 161

 Worm   264 ISVYAGHTAQFQCKVKSNENTIIKWLKE------------VSDPLSIRRKDPNSTVIHVNGMNLL 316
            .:...|....|||:|.|.|:..|||.:.            .|.|.:   .:.::.::..||....
  Fly   162 KTTLVGSRVVFQCRVHSEEHPTIKWFRRQTYVGTQSGGEASSAPTT---SNFSNHIVRYNGRTYE 223

 Worm   317 VLDHIQTESSLPQEDMDNIYTNRLTIHKVDYHHAGKYICVVTSAQGQIVYKSAELKVLSAYDFT 380
            :|.....:...||     ||.::|.:..|....||.|.||..|.:|..: :.|.|.||:..:.|
  Fly   224 LLSTDPEKMMAPQ-----IYLSKLILDGVRLRDAGHYACVAISYRGHKI-REAFLDVLADVEDT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
igcm-4NP_508377.1 IGc2 52..114 CDD:197706
I-set 159..235 CDD:254352 22/97 (23%)
IGc2 166..225 CDD:197706 18/82 (22%)
IG_like 261..373 CDD:214653 32/123 (26%)
Ig 269..374 CDD:299845 30/116 (26%)
CG31431NP_001247231.1 IG_like 159..274 CDD:214653 32/123 (26%)
Ig 167..275 CDD:299845 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19890
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.