DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inso-1 and Shawl

DIOPT Version :9

Sequence 1:NP_508239.2 Gene:inso-1 / 180473 WormBaseID:WBGene00016871 Length:271 Species:Caenorhabditis elegans
Sequence 2:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster


Alignment Length:91 Identity:33/91 - (36%)
Similarity:44/91 - (48%) Gaps:13/91 - (14%)


- Green bases have known domain annotations that are detailed below.


 Worm    86 LNVGGKVFQTTRSTLMREPCSFLYRLCQDEMGLPTDRDETGAYLIDRDPDFFSPILNYLRHGKL- 149
            |||.|..::|.::||.:.|.:.|.||.:   .|.........|..||.|..|:.||||.|.||| 
  Fly     9 LNVSGIRYETYKATLKKIPATRLSRLTE---ALANYDPVLNEYFFDRHPGVFTQILNYYRTGKLH 70

 Worm   150 ----IMNPGLSEEGILAEADFYNLPS 171
                :..| |.||    |.:|:.|.|
  Fly    71 YPTDVCGP-LFEE----ELEFWGLDS 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inso-1NP_508239.2 BTB_POZ_KCTD2-like 83..167 CDD:349671 30/85 (35%)
ShawlNP_001097131.2 BTB 7..99 CDD:197585 33/91 (36%)
BTB_2 7..97 CDD:280393 33/91 (36%)
Ion_trans 307..506 CDD:278921
Ion_trans_2 <449..499 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.