DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F13C5.2 and tbrd-3

DIOPT Version :9

Sequence 1:NP_508124.1 Gene:F13C5.2 / 180410 WormBaseID:WBGene00017423 Length:374 Species:Caenorhabditis elegans
Sequence 2:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster


Alignment Length:227 Identity:63/227 - (27%)
Similarity:101/227 - (44%) Gaps:33/227 - (14%)


- Green bases have known domain annotations that are detailed below.


 Worm   102 AKSESEDEAESDHLHDELKKCLSILKEFEKSTHDSFTFPFRKPVDVVLLGLTDYHEVIKKPMDMS 166
            ||.|:|..:      .|:..|..|:|....||:.:..:.|.:|:|..||||.||||::::|||:|
  Fly     3 AKQETERSS------PEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLS 61

 Worm   167 TIRKKLIGEEYDTAVEFKEDFKLMINNCLTYNNEGDPVADFALQFRKKFAAKWKKEFPEDGDSFG 231
            |:|.:|....|.:|.:|.:|.:|:..|...|.|........|.|.:..|     :|.......:.
  Fly    62 TVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIF-----EEMYSQVQLYI 121

 Worm   232 QEKGEKEGSDNEDDEEEVDEKEKEEEVKEDNAEEKPA---EEPEQPDEKEEEDHED-------ER 286
            ...|.|..::.|...:|.|....|:||  :.:|..|:   ..|......|.....|       |.
  Fly   122 CSSGSKVRAEEESSSDESDSSSPEDEV--NGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLET 184

 Worm   287 EEQEEEDSSDEEDGLD--------DDDVRRHI 310
            .||:|..:::|:  ||        |.:|..|:
  Fly   185 SEQQEPFTTEED--LDLHAKIQQLDGEVLLHV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F13C5.2NP_508124.1 Bromodomain 118..219 CDD:383021 35/100 (35%)
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 36/105 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I3803
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.