DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ife-2 and eIF4EHP

DIOPT Version :9

Sequence 1:NP_508094.1 Gene:ife-2 / 180393 WormBaseID:WBGene00002060 Length:228 Species:Caenorhabditis elegans
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:133 Identity:43/133 - (32%)
Similarity:70/133 - (52%) Gaps:12/133 - (9%)


- Green bases have known domain annotations that are detailed below.


 Worm    18 KLKRNWTWWYLNDERNKS---WEERLKNVKTFSSVGEFWALHDSIKPPSGLNPPSDYNVFRDGIE 79
            :|:..:..|:...|..::   :.:.|..|...:||.::|:|:..:..|:.|.|..:..:|:.||.
  Fly    47 RLQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGII 111

 Worm    80 PMWEVPQNQNGGRWLITIEKGRTPEIMDTIWTEILMAMIGEQF--SDDIESLCGIVCNVRGKGSK 142
            ||||.|.|..||:|||.:.|.:    :|..|..:.|||:||||  .|:|   ||:|...:.....
  Fly   112 PMWEDPANSKGGQWLIRLRKNK----VDRAWENVCMAMLGEQFLVGDEI---CGVVLQTKYPNPS 169

 Worm   143 ISV 145
            |.|
  Fly   170 IQV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ife-2NP_508094.1 IF4E 23..168 CDD:279921 42/128 (33%)
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 41/128 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.