DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ife-2 and eIF4EHP

DIOPT Version :10

Sequence 1:NP_508094.1 Gene:ife-2 / 180393 WormBaseID:WBGene00002060 Length:228 Species:Caenorhabditis elegans
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:59 Identity:11/59 - (18%)
Similarity:21/59 - (35%) Gaps:20/59 - (33%)


- Green bases have known domain annotations that are detailed below.


 Worm   100 GYYYPPPKSGGNYPYTPPPNPIVPYFPFYYYNPPPQSVMSGSDAKIRFSYGVSFILIFS 158
            |:....|..|.|.||                    |:|:.|.......:..::|:::|:
  Fly     6 GHSVHNPLRGTNIPY--------------------QNVLCGPLPYTVVARHLAFVIVFT 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ife-2NP_508094.1 IF4E 18..168 CDD:460281 11/59 (19%)
eIF4EHPNP_001163710.1 IF4E 48..>172 CDD:460281
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.