DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurog1 and net

DIOPT Version :10

Sequence 1:NP_035026.1 Gene:Neurog1 / 18014 MGIID:107754 Length:244 Species:Mus musculus
Sequence 2:NP_524820.2 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster


Alignment Length:167 Identity:34/167 - (20%)
Similarity:64/167 - (38%) Gaps:42/167 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   226 RENT------YPFLAMIMLKDRKMTV----------------VG-----RLEGLIQPED---LIN 260
            ||.|      |...:.::.::.::|:                ||     .:||.:.|.|   |..
  Fly   242 REETKSRFTEYSMSSSVIRRNEQLTLLDDRFEKFFEQYDDPEVGPLDCEEIEGHVDPNDDVLLRC 306

Mouse   261 QLTFIMEANQTYLMSERLEREERNQTQVLRQQQDEAYEASLRADQEKDRKKREEQEQKRQEEEKV 325
            ...|..|.:..|    ..|.|::...:.|.|.||:      .:::|:...:.|:.|||:.:.|.:
  Fly   307 AAEFKRERDAVY----DAEYEKQWIRERLTQLQDD------NSEEEEVAMQVEDGEQKKWDCESI 361

Mouse   326 RQTVLAEERRRRTLEEEKERRSECLPAEPPVDDPDGV 362
            ..|........:.::|.|:.|.  :...|....|:.|
  Fly   362 LSTYSNIYNHPKLIQEPKKTRK--ILINPKTGLPENV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurog1NP_035026.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..82
bHLH_TS_NGN1_NeuroD3 83..154 CDD:381559
netNP_524820.2 bHLH_TS_ATOH8 262..329 CDD:381427 13/70 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.