DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurog1 and dimm

DIOPT Version :9

Sequence 1:NP_035026.1 Gene:Neurog1 / 18014 MGIID:107754 Length:244 Species:Mus musculus
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:232 Identity:70/232 - (30%)
Similarity:98/232 - (42%) Gaps:59/232 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 DLDCSSSNSSSDLSS----------FLTD---EEDCA----------RLQPLASTSGLSVPARRS 52
            ||:.:.|:|.||.:|          ..|:   ...|:          |:|..:|.:..|..|..|
  Fly    65 DLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNS 129

Mouse    53 APALSGASNVPGAQDEEQERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALR 117
            ..  |.:||..|     ...|||:|       ||....|..||:::|:|||.|||:||.|..:||
  Fly   130 TS--SNSSNANG-----NASRRRKG-------ALNAKERNMRRLESNERERMRMHSLNDAFQSLR 180

Mouse   118 SVLPSFPDDTKLTKIETLRFAYNYIWAL-----------AETLRLADQGLPGGSARERLLPPQCV 171
            .|:|....:.:|:|||||..|.|||..|           |..|.| :.|..||.....|......
  Fly   181 EVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALEL-NSGAVGGVLLSNLSSESGG 244

Mouse   172 PCLPGPPSPAS-------DTESWGSGAAASPCATVAS 201
            |...|.|:.::       ||.:.|   .|..||.:|:
  Fly   245 PVASGIPANSNAATICFEDTLASG---GAFDCAILAA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurog1NP_035026.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 7/25 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..82 12/42 (29%)
HLH 91..150 CDD:238036 29/69 (42%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.