DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurog1 and HLH4C

DIOPT Version :10

Sequence 1:NP_035026.1 Gene:Neurog1 / 18014 MGIID:107754 Length:244 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:136 Identity:44/136 - (32%)
Similarity:57/136 - (41%) Gaps:20/136 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    37 QPLASTSGLSVPARRSAP-ALSGASNVPGAQDEEQERRRRRGRARVRSEALLHSLRRSRRVKAND 100
            ||.........|.||:.| |....|.:.|...||: |||||...:.|:   .|:          .
  Fly    65 QPAPPPPPTPAPRRRTTPIAHLDPSELVGLSREER-RRRRRATLKYRT---AHA----------T 115

Mouse   101 RERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGSARERL 165
            |||.|:...|.:...||.:||:.|.|.||:|||.|:.|..||..|...|.     .|..||....
  Fly   116 RERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLE-----TPXDSAGASS 175

Mouse   166 LPPQCV 171
            ....|:
  Fly   176 FATSCL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurog1NP_035026.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..82 14/43 (33%)
bHLH_TS_NGN1_NeuroD3 83..154 CDD:381559 23/70 (33%)
HLH4CNP_001259243.1 bHLH_TS_HEN1 105..165 CDD:381544 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.