DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod2 and dimm

DIOPT Version :9

Sequence 1:NP_035025.3 Gene:Neurod2 / 18013 MGIID:107755 Length:383 Species:Mus musculus
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:269 Identity:79/269 - (29%)
Similarity:108/269 - (40%) Gaps:82/269 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse   108 KKRKMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIW 172
            ::||......||: :||.::|.|||.|||.||.|..:||:|:|.....::|||||||.||||||.
  Fly   143 RRRKGALNAKERN-MRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYII 206

Mouse   173 ALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADG----AGRFHGSGG 233
            .|:.|:.| ||                   |..|..|:|||       ||.|    :.....|||
  Fly   207 NLTHIILS-KR-------------------NEEAAALELNS-------GAVGGVLLSNLSSESGG 244

Mouse   234 PFAMHPYPYPCSRLAGAQC----QAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGG-------- 286
            |.|.   ..|.:..|...|    .|:||                |::....||..|.        
  Fly   245 PVAS---GIPANSNAATICFEDTLASGG----------------AFDCAILAATDGSLLNAATVT 290

Mouse   287 ASPDYNSSEYEG-PLSPPLCLNGNFSLKQDSS--PDHEKSYHYSMHYSA-----------LPGSR 337
            .||...|.:.:. .|..|:     ...:|.:|  |.|:::.|...|..|           |.|:.
  Fly   291 TSPAMQSIQSQAIHLQTPM-----EQQQQQASHLPHHQQAMHGHGHLGASIQSQQQPSLVLNGTT 350

Mouse   338 PTGHGLVFG 346
            ..|.|:..|
  Fly   351 SVGLGIGIG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod2NP_035025.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..130 7/21 (33%)
bHLH_TS_NeuroD2 89..181 CDD:381563 35/72 (49%)
Nuclear localization signal. /evidence=ECO:0000255 108..114 2/5 (40%)
Neuro_bHLH 181..311 CDD:372170 31/146 (21%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/54 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.