DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod1 and twi

DIOPT Version :9

Sequence 1:NP_035024.1 Gene:Neurod1 / 18012 MGIID:1339708 Length:357 Species:Mus musculus
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:94 Identity:35/94 - (37%)
Similarity:54/94 - (57%) Gaps:6/94 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    79 QKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETL 143
            :||:||..:|...|: ..:.|..:|:.||.|||.|...||.|..:|::::|.. .:.|||||:||
  Fly   341 RKPRRRLKRKPSKTE-ETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTL-PSDKLSKIQTL 403

Mouse   144 RLAKNYIWALSEILRSGKSPDLVSFVQTL 172
            :||..||..|..:|.|..    :|.::.|
  Fly   404 KLATRYIDFLCRMLSSSD----ISLLKAL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod1NP_035024.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 6/14 (43%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 1/5 (20%)
HLH 100..158 CDD:238036 24/57 (42%)
Neuro_bHLH 160..284 CDD:289310 2/13 (15%)
twiNP_001033967.1 HLH 363..413 CDD:278439 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.