DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod1 and dimm

DIOPT Version :9

Sequence 1:NP_035024.1 Gene:Neurod1 / 18012 MGIID:1339708 Length:357 Species:Mus musculus
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:246 Identity:65/246 - (26%)
Similarity:99/246 - (40%) Gaps:61/246 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    82 KRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLA 146
            :|:|....|      || .:||:::|.|||.|||.||.|..:||:|:|.....::|||||||.||
  Fly   144 RRKGALNAK------ER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLA 201

Mouse   147 KNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNPDMPPHLPTAS 211
            ||||..|:.|:.|.::.:..:.         :..:..|.|.|..|               |.:.|
  Fly   202 KNYIINLTHIILSKRNEEAAAL---------ELNSGAVGGVLLSN---------------LSSES 242

Mouse   212 ASFPVHPYSYQSPGLPSPPYG-------TMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSF 269
            .. ||      :.|:|:....       |:.|...|..     |..||.:....:..|..|||:.
  Fly   243 GG-PV------ASGIPANSNAATICFEDTLASGGAFDC-----AILAATDGSLLNAATVTTSPAM 295

Mouse   270 DGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGPQSHGSIFSS 320
            .       ||.........|..:.::..:...|:..|.    ..||.:.:|
  Fly   296 Q-------SIQSQAIHLQTPMEQQQQQASHLPHHQQAM----HGHGHLGAS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod1NP_035024.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 3/11 (27%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 1/5 (20%)
HLH 100..158 CDD:238036 31/57 (54%)
Neuro_bHLH 160..284 CDD:289310 22/130 (17%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 30/54 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.