DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Septin2 and pnut

DIOPT Version :9

Sequence 1:XP_006529303.1 Gene:Septin2 / 18000 MGIID:97298 Length:391 Species:Mus musculus
Sequence 2:NP_477064.1 Gene:pnut / 35801 FlyBaseID:FBgn0013726 Length:539 Species:Drosophila melanogaster


Alignment Length:375 Identity:186/375 - (49%)
Similarity:254/375 - (67%) Gaps:11/375 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse    10 DNWTGGPHLGDPAGQTGKSRKMSKQQPTQFINPETP---------GYVGFANLPNQVHRKSVKKG 65
            |...||...||....|...::...||..:...|..|         ||||||||||||:||:||:|
  Fly    76 DTSGGGASNGDSNKLTHDLQEKEHQQAQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKRG 140

Mouse    66 FEFTLMVVGESGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQIEASTVEIEERGVKLRLTVV 130
            |||||||||.|||||||||||:||:|:|.....||.:.:.::||.:||:.|.::|.||.|.||||
  Fly   141 FEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVV 205

Mouse   131 DTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDV 195
            ||||:|||::..:|:..|:.|:|.::|.||..||.:.|:.|.|:|||||.|||:|.||||.|||:
  Fly   206 DTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLDI 270

Mouse   196 AFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKIYHLPDAESDEDEDFKEQTRL 260
            |.|:::.:|||:|||||||||:|..|....||:||:||.:|.||||..|....|..|:.| .|:.
  Fly   271 ACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPATLEDAAEEAK-TTQN 334

Mouse   261 LKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDL 324
            |::.:||:|||:|.:||..|||||||.||||:|||||..|.||:.||.|:| ||:|||::||.::
  Fly   335 LRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNV 399

Mouse   325 HYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQ 374
            ||||:|..:|...|.......::....|.:.|.|.|..::.:.:|:|:|:
  Fly   400 HYENYRCRKLSELGLVDGKARLSNKNPLTQMEEEKREHEQKMKKMEAEME 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Septin2XP_006529303.1 Septin 64..343 CDD:366275 153/279 (55%)
pnutNP_477064.1 CDC3 121..482 CDD:227352 176/330 (53%)
Septin 139..411 CDD:279124 152/272 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51878
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2060
SonicParanoid 1 1.000 - - X204
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.