DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bir-2 and Bruce

DIOPT Version :9

Sequence 1:NP_506362.1 Gene:bir-2 / 179841 WormBaseID:WBGene00000250 Length:308 Species:Caenorhabditis elegans
Sequence 2:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster


Alignment Length:223 Identity:59/223 - (26%)
Similarity:88/223 - (39%) Gaps:53/223 - (23%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MPYT-----FENSEALLKNLKDAAPYISAA----ER----------------FASFKGFVYDKRI 40
            :||:     ..|...|||.|:...|.::.|    ||                |::|:..:.....
  Fly   185 VPYSSLKLVSNNMVILLKRLERHIPVLAIASAINERLTDMMMGSRVPDFGWNFSNFQRVLMHSEA 249

 Worm    41 NIACTSEK-------------LARAGFYSTASPEFPASAKCPFC-MLEINFEQCDDPWEKHKSGS 91
            ....|.||             :|:||||...|......|.|..| :..:.:|:.|:||.:|:..|
  Fly   250 VRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHS 314

 Worm    92 PHCEFVMIGEIEESELSFRIISNLAIRHAT-VRLYEELLGIVATLENGDIANENPITRADATRKL 155
            |.|.||. ||..::       ..|:|.:|| ..|....||. ..:.|.|.||. ..|....|.:|
  Fly   315 PLCPFVK-GEYTQN-------VPLSITYATNPALPAPGLGF-DIISNSDYANV-LCTSCSQTGEL 369

 Worm   156 I--SFRSSSKLLTFDHRLATFQNFIFDK 181
            .  |.....||:...| :.|..|:||::
  Fly   370 SVWSIERHLKLMHTFH-VPTLLNYIFEE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bir-2NP_506362.1 BIR 23..99 CDD:197595 27/109 (25%)
BIR 166..242 CDD:197595 5/16 (31%)
BruceNP_001262460.1 BIR 251..321 CDD:279047 21/69 (30%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I7415
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.