DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ncam2 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:338 Identity:81/338 - (23%)
Similarity:128/338 - (37%) Gaps:65/338 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse   117 FREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWL---------YHNEEVTTIPDNRFAVLANN--N 170
            |.|.:|......|.||...|.|.......|.||         .|...:|..|....:.|..|  |
  Fly    44 FVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWN 108

Mouse   171 LQILNINKSDEGIYRCEGRVE-ARGEIDFRDIIVIVNVPPAIMMPQKSFNATAERGEEMTLTCKA 234
            |.|..:::.|.|.|.|:...: .:.:|.|.|::    :||..:....|.:.....|..:.|||:|
  Fly   109 LHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVV----IPPDFISEDTSSDVIVPEGSSVRLTCRA 169

Mouse   235 SGSPDPTISWFRNGKLIEENEKYILK---GSNT--------ELTVRNIINKDGGSYVCKATNKAG 288
            .|.|:|.::|.|     |:..:.:||   |:.|        .|.:..|...:.|||:|.|:|...
  Fly   170 RGYPEPIVTWRR-----EDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVP 229

Mouse   289 ED-QKQAFLQVFVQPHILQLKNETTSE--NGHVTLVCEAEGEPVPEITWKRAIDGVMFSEG---- 346
            .. .|:..|.:...| ::|:.|:....  ...|.:.|..|..|.....|.:....::.:.|    
  Fly   230 PSVSKRISLSIHFHP-VIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHV 293

Mouse   347 DKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEYAPKFVSNQTMYY 411
            .:|.....|.|     .|:.:|..:..|.|.|.|.|.:.:|....|:.|               |
  Fly   294 QESSQSMYETK-----MSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRL---------------Y 338

Mouse   412 SWEG-----NPIN 419
            ...|     ||:|
  Fly   339 EIPGPNRNKNPLN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274
I-set 22..111 CDD:254352
I-set 117..193 CDD:254352 23/87 (26%)
IGc2 128..189 CDD:197706 20/71 (28%)
Ig 208..301 CDD:299845 28/104 (27%)
I-set 215..298 CDD:254352 26/94 (28%)
Ig 300..397 CDD:299845 22/102 (22%)
IG_like 308..395 CDD:214653 19/92 (21%)
IG_like 413..491 CDD:214653 4/12 (33%)
IGc2 414..482 CDD:197706 4/11 (36%)
FN3 496..588 CDD:238020
fn3 594..678 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 21/79 (27%)
Ig 51..131 CDD:299845 20/79 (25%)
I-set 144..240 CDD:254352 27/100 (27%)
IGc2 159..228 CDD:197706 23/73 (32%)
Ig 244..337 CDD:299845 21/98 (21%)
I-set 244..337 CDD:254352 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.